SimulationCraft 902-01

for World of Warcraft 9.0.2.36710 Live (wow build level 36710)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Monk

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-11-21 Manually set Periodic Damage Windwalker Monk Two-Hand Adjustment by 2%
Windwalker Monk Two-Hand Adjustment (effect#2) base_value 2.00 0.00
2020-11-21 Manually set Direct Damage Windwalker Monk Two-Hand Adjustment by 2%
Windwalker Monk Two-Hand Adjustment (effect#1) base_value 2.00 0.00

Warlock

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-11-15 Manually set secondary Malefic Rapture level requirement
Malefic Rapture spell_level 11.00 43.00

Table of Contents

Raid Summary

Additional Raid Information

arcane : 8901 dps, 4549 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8900.6 8900.6 16.9 / 0.189% 1168.9 / 13.1% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2054.4 1946.7 Mana 0.00% 48.6 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 8901
Arcane Barrage 3735 42.0% 50.4 5.98sec 22291 18197 Direct 151.1 6316 12942 7441 17.0%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.42 151.05 0.00 0.00 1.2250 0.0000 1123789.68 1123789.68 0.00% 18196.96 18196.96
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.03% 125.42 91 166 6316.01 2168 30681 6306.53 5507 7164 791828 791828 0.00%
crit 16.97% 25.64 10 49 12942.20 4337 61362 12928.26 7844 19269 331962 331962 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.42
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 908 1817 1046 15.2%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1046.62 1046.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.79% 0.85 0 1 908.48 908 908 770.33 0 908 770 770 0.00%
crit 15.21% 0.15 0 1 1816.95 1817 1817 276.28 0 1817 276 276 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2954 33.2% 130.8 2.28sec 6790 5559 Direct 392.3 1916 3935 2263 17.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 130.77 392.30 0.00 0.00 1.2214 0.0000 887957.41 887957.41 0.00% 5559.36 5559.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.81% 324.87 231 421 1916.48 1449 3566 1917.02 1788 2044 622576 622576 0.00%
crit 17.19% 67.43 37 103 3935.47 2899 7133 3935.14 3362 4592 265382 265382 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:130.77
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1012 11.4% 24.6 11.77sec 12380 6542 Periodic 195.9 1320 2688 1553 17.0% 4.5%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.57 0.00 196.03 195.90 1.8923 0.2055 304199.13 304199.13 0.00% 6542.34 6542.34
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.95% 162.50 66 261 1320.05 1062 2614 1320.19 1135 1644 214452 214452 0.00%
crit 17.05% 33.40 10 62 2687.66 2125 5228 2682.77 2219 3435 89747 89747 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.57
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (590) 0.0% (6.6%) 12.7 24.32sec 13937 11354

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.73 0.00 0.00 0.00 1.2275 0.0000 0.00 0.00 0.00% 11353.54 11353.54

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.73
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 590 6.6% 38.1 24.32sec 4651 0 Direct 38.1 3935 8073 4654 17.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.14 38.14 0.00 0.00 0.0000 0.0000 177410.47 177410.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 31.53 20 43 3935.44 2864 7048 3932.67 3144 4552 124089 124089 0.00%
crit 17.33% 6.61 0 16 8072.92 5728 14096 8064.04 0 13697 53322 53322 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 16 (25) 0.2% (0.3%) 14.6 1.71sec 505 0 Periodic 41.3 (43.3) 111 0 111 0.0% (0.0%) 4.5%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.59 0.00 41.26 41.26 0.0000 0.9869 4598.35 4598.35 0.00% 181.06 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 41.26 12 64 111.43 0 202 111.54 69 166 4598 4598 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 2.1 9.41sec 1338 0 Direct 2.1 1113 2231 1338 20.2%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.07 2.07 0.00 0.00 0.0000 0.0000 2773.50 2773.50 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.84% 1.65 0 3 1112.99 1093 1158 1056.18 0 1158 1842 1842 0.00%
crit 20.16% 0.42 0 2 2230.83 2185 2316 821.94 0 2316 932 932 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.5 14.38sec 528 0 Direct 20.5 452 903 528 16.7%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.50 20.50 0.00 0.00 0.0000 0.0000 10815.39 10815.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.25% 17.07 8 29 451.98 444 470 451.96 444 464 7714 7714 0.00%
crit 16.75% 3.43 0 10 903.31 887 941 871.27 0 941 3102 3102 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4241 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 106  / 14 0.2% 93.0 1.27sec 46 35 Direct 93.0 38 78 46 18.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 93.00 93.00 0.00 0.00 1.2884 0.0000 4241.09 4241.09 0.00% 35.40 35.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.55% 75.84 63 87 38.31 30 46 38.31 37 40 2905 2905 0.00%
crit 18.45% 17.16 6 30 77.83 59 91 77.84 67 89 1336 1336 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:32.00
Touch of the Magi 0 (531) 0.0% (6.0%) 6.2 51.79sec 25596 19898

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.23 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19897.85 19897.85

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.25
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 531 6.0% 6.2 51.68sec 25596 0 Direct 18.6 8555 0 8555 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.23 18.64 0.00 0.00 0.0000 0.0000 159461.35 159461.35 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.64 15 24 8555.37 356 40958 8543.05 5652 11514 159461 159461 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19064.57
  • base_dd_max:19064.57
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.9 126.78sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.88
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 253.35sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [x]:1.88
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.50 0.00 2.93 0.00 4.2050 0.7097 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.49
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.24sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.09 0.00 0.00 0.00 1.2379 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.11
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.31sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.76
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 51.2 137.7 5.9sec 1.6sec 4.6sec 78.03% 0.00% 2.9 (3.9) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.2s / 16.6s
  • trigger_min/max:0.0s / 8.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.3s

Stack Uptimes

  • arcane_charge_1:20.68%
  • arcane_charge_2:17.66%
  • arcane_charge_3:16.85%
  • arcane_charge_4:22.84%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 126.8sec 126.8sec 14.7sec 14.09% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 138.5s
  • trigger_min/max:120.0s / 138.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.09%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 253.3sec 253.3sec 11.7sec 7.28% 17.67% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.2s / 272.9s
  • trigger_min/max:241.2s / 272.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.28%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.7 0.0 11.8sec 11.8sec 1.3sec 10.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.48%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.02% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.5s
  • trigger_min/max:60.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.32%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 150.3sec 150.3sec 4.2sec 0.69% 0.00% 2.0 (2.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:150.3s / 150.3s
  • trigger_min/max:150.3s / 150.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:0.70%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 4.0 0.0 83.4sec 83.4sec 14.6sec 19.61% 0.00% 0.0 (0.0) 3.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 138.3s
  • trigger_min/max:60.0s / 138.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.61%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 9.0 0.0 34.8sec 34.8sec 11.8sec 35.18% 0.00% 0.0 (0.0) 8.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 62.6s
  • trigger_min/max:12.1s / 62.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.18%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.70% 0.69% 6.21% 0.8s 0.0s 4.3s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation218.81560.271352.569269.178151.356359.901
Rune of Power5.8600.00335.12237.05316.20070.152
Touch of the Magi4.5870.00029.71530.15113.48658.317
Arcane Power4.8530.00018.47414.1492.53234.191
Arcane Barrage3.4980.00014.042178.080137.118216.892
Arcane Orb4.2010.00017.91854.22530.51586.781

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 1053.35 407056.48 69.52% 386.44 8424.89 2.03%
Evocation Mana 22.95 25780.27 4.40% 1123.25 0.00 0.00%
Mana Gem Mana 2.76 19090.71 3.26% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.42 133580.38 22.81% 2649.41 5909.91 4.24%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1946.73 2054.39 14306.4 36779.9 224.3 69165.7
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 130.8 595207.2 4551.6 4551.6 1.5
arcane_orb Mana 12.7 5786.2 454.4 454.5 30.7
touch_of_the_magi Mana 6.2 15563.3 2499.5 2498.2 10.2

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
arcane Damage Per Second
Count 1118
Mean 8900.61
Minimum 8083.50
Maximum 9757.57
Spread ( max - min ) 1674.07
Range [ ( max - min ) / 2 * 100% ] 9.40%
Standard Deviation 287.6247
5th Percentile 8428.79
95th Percentile 9387.42
( 95th Percentile - 5th Percentile ) 958.62
Mean Distribution
Standard Deviation 8.6021
95.00% Confidence Interval ( 8883.75 - 8917.47 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4012
0.1 Scale Factor Error with Delta=300 707
0.05 Scale Factor Error with Delta=300 2825
0.01 Scale Factor Error with Delta=300 70622
Priority Target DPS
arcane Priority Target Damage Per Second
Count 1118
Mean 4548.60
Minimum 3953.98
Maximum 5343.53
Spread ( max - min ) 1389.56
Range [ ( max - min ) / 2 * 100% ] 15.27%
Standard Deviation 204.9017
5th Percentile 4222.25
95th Percentile 4887.44
( 95th Percentile - 5th Percentile ) 665.19
Mean Distribution
Standard Deviation 6.1281
95.00% Confidence Interval ( 4536.59 - 4560.61 )
Normalized 95.00% Confidence Interval ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 78
0.1% Error 7796
0.1 Scale Factor Error with Delta=300 359
0.05 Scale Factor Error with Delta=300 1434
0.01 Scale Factor Error with Delta=300 35841
DPS(e)
arcane Damage Per Second (Effective)
Count 1118
Mean 8900.61
Minimum 8083.50
Maximum 9757.57
Spread ( max - min ) 1674.07
Range [ ( max - min ) / 2 * 100% ] 9.40%
Damage
arcane Damage
Count 1118
Mean 2672051.90
Minimum 2001616.65
Maximum 3227843.23
Spread ( max - min ) 1226226.58
Range [ ( max - min ) / 2 * 100% ] 22.95%
DTPS
arcane Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.25 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.88 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.11 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.73 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.57 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 130.77 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.42 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.49 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.76 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
x 1.88 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
y 4.04 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxytqrtsssrstssssptsssvstqtsssstsssstsssstsssstqtsssrstsssrsrtnptqtssrssrtsssstsssstqtsssrstssrsstnptqtsssrstssssoyrtssvrsstqtssssrtsssstnptqtssssrtsssstssssrtqtsssstsusrnptqtsssstsssstssssrtqtsrssstsssstsnoxytqvtsssstssssptssrsstqtssrsstssssts

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask arcane 69165.7/69166: 100% mana
Pre precombat U food arcane 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana
0:01.287 aoe o arcane_power Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, clearcasting, crimson_chorus
0:01.287 shared_cds w potion Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus
0:01.287 shared_cds x berserking Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.287 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.287 aoe t arcane_barrage Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.187 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.088 aoe r arcane_missiles Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.525 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.425 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.327 aoe s arcane_explosion Fluffy_Pillow 67913.5/69166: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.227 aoe s arcane_explosion Fluffy_Pillow 66658.4/69166: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.128 aoe r arcane_missiles Fluffy_Pillow 65404.8/69166: 95% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.640 aoe s arcane_explosion Fluffy_Pillow 67496.4/69166: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.540 aoe t arcane_barrage Fluffy_Pillow 66241.4/69166: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.442 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, berserking, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.342 aoe s arcane_explosion Fluffy_Pillow 67910.7/69166: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.241 aoe s arcane_explosion Fluffy_Pillow 66654.3/69166: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.142 aoe s arcane_explosion Fluffy_Pillow 65400.7/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.132 aoe p rune_of_power Fluffy_Pillow 64270.1/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.122 aoe t arcane_barrage Fluffy_Pillow 65639.6/69166: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.112 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:18.103 aoe s arcane_explosion Fluffy_Pillow 65536.6/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.094 aoe s arcane_explosion Fluffy_Pillow 61907.4/69166: 90% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.087 shared_cds v use_mana_gem arcane 58281.1/69166: 84% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:20.087 aoe s arcane_explosion Fluffy_Pillow 65197.6/69166: 94% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.077 aoe t arcane_barrage Fluffy_Pillow 61567.1/69166: 89% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.066 aoe q arcane_orb Fluffy_Pillow 65701.9/69166: 95% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.179 aoe t arcane_barrage Fluffy_Pillow 66741.5/69166: 96% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.169 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.161 aoe s arcane_explosion Fluffy_Pillow 65538.0/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.151 aoe s arcane_explosion Fluffy_Pillow 61907.4/69166: 90% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.141 aoe s arcane_explosion Fluffy_Pillow 58276.9/69166: 84% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3)
0:28.131 aoe t arcane_barrage Fluffy_Pillow 54646.4/69166: 79% mana bloodlust, arcane_charge(4), crimson_chorus(3)
0:29.123 aoe s arcane_explosion Fluffy_Pillow 58785.3/69166: 85% mana bloodlust, crimson_chorus(3)
0:30.114 aoe s arcane_explosion Fluffy_Pillow 55156.1/69166: 80% mana bloodlust, arcane_charge
0:31.106 aoe s arcane_explosion Fluffy_Pillow 51528.4/69166: 74% mana bloodlust, arcane_charge(2)
0:32.097 aoe s arcane_explosion Fluffy_Pillow 47899.3/69166: 69% mana bloodlust, arcane_charge(3)
0:33.086 aoe t arcane_barrage Fluffy_Pillow 44267.4/69166: 64% mana bloodlust, arcane_charge(4)
0:34.078 aoe s arcane_explosion Fluffy_Pillow 48406.2/69166: 70% mana bloodlust
0:35.069 aoe s arcane_explosion Fluffy_Pillow 44777.1/69166: 65% mana bloodlust, arcane_charge
0:36.061 aoe s arcane_explosion Fluffy_Pillow 41149.3/69166: 59% mana bloodlust, arcane_charge(2)
0:37.052 aoe s arcane_explosion Fluffy_Pillow 37520.2/69166: 54% mana bloodlust, arcane_charge(3)
0:38.044 aoe t arcane_barrage Fluffy_Pillow 33892.5/69166: 49% mana bloodlust, arcane_charge(4)
0:39.033 aoe s arcane_explosion Fluffy_Pillow 38027.2/69166: 55% mana bloodlust
0:40.023 aoe s arcane_explosion Fluffy_Pillow 34396.7/69166: 50% mana bloodlust, arcane_charge
0:41.013 aoe s arcane_explosion Fluffy_Pillow 30766.1/69166: 44% mana arcane_charge(2)
0:42.298 aoe s arcane_explosion Fluffy_Pillow 27543.7/69166: 40% mana arcane_charge(3)
0:43.583 aoe t arcane_barrage Fluffy_Pillow 24321.3/69166: 35% mana arcane_charge(4)
0:44.870 aoe q arcane_orb Fluffy_Pillow 28868.2/69166: 42% mana
0:46.156 aoe t arcane_barrage Fluffy_Pillow 30147.2/69166: 44% mana arcane_charge(4)
0:47.445 aoe s arcane_explosion Fluffy_Pillow 34696.9/69166: 50% mana
0:48.732 aoe s arcane_explosion Fluffy_Pillow 31477.2/69166: 46% mana arcane_charge
0:50.019 aoe s arcane_explosion Fluffy_Pillow 28257.5/69166: 41% mana arcane_charge(2)
0:51.307 aoe r arcane_missiles Fluffy_Pillow 25039.2/69166: 36% mana arcane_charge(3), clearcasting
0:53.269 aoe s arcane_explosion Fluffy_Pillow 27753.3/69166: 40% mana arcane_charge(3)
0:54.556 aoe t arcane_barrage Fluffy_Pillow 24533.6/69166: 35% mana arcane_charge(4)
0:55.842 aoe s arcane_explosion Fluffy_Pillow 29079.2/69166: 42% mana
0:57.128 aoe s arcane_explosion Fluffy_Pillow 25858.1/69166: 37% mana arcane_charge
0:58.414 aoe s arcane_explosion Fluffy_Pillow 22637.1/69166: 33% mana arcane_charge(2)
0:59.702 aoe r arcane_missiles Fluffy_Pillow 19418.8/69166: 28% mana arcane_charge(3), clearcasting
1:01.676 aoe s arcane_explosion Fluffy_Pillow 22149.5/69166: 32% mana arcane_charge(3), crimson_chorus
1:02.963 aoe r arcane_missiles Fluffy_Pillow 18929.8/69166: 27% mana arcane_charge(4), clearcasting, crimson_chorus
1:04.906 aoe t arcane_barrage Fluffy_Pillow 21617.6/69166: 31% mana arcane_charge(4), crimson_chorus
1:06.193 aoe n touch_of_the_magi Fluffy_Pillow 26164.5/69166: 38% mana crimson_chorus
1:07.480 aoe p rune_of_power Fluffy_Pillow 25444.8/69166: 37% mana arcane_charge(4), crimson_chorus
1:08.767 aoe t arcane_barrage Fluffy_Pillow 27225.2/69166: 39% mana arcane_charge(4), rune_of_power, crimson_chorus
1:10.054 aoe q arcane_orb Fluffy_Pillow 31772.1/69166: 46% mana rune_of_power, crimson_chorus
1:11.340 aoe t arcane_barrage Fluffy_Pillow 33051.1/69166: 48% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:12.626 aoe s arcane_explosion Fluffy_Pillow 37596.6/69166: 54% mana rune_of_power, crimson_chorus(2)
1:13.911 aoe s arcane_explosion Fluffy_Pillow 34374.2/69166: 50% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:15.197 aoe r arcane_missiles Fluffy_Pillow 31153.1/69166: 45% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(2)
1:17.072 aoe s arcane_explosion Fluffy_Pillow 33746.8/69166: 49% mana arcane_charge(2), rune_of_power, crimson_chorus(2)
1:18.357 aoe s arcane_explosion Fluffy_Pillow 30524.4/69166: 44% mana arcane_charge(3), rune_of_power, crimson_chorus(2)
1:19.643 aoe r arcane_missiles Fluffy_Pillow 27303.3/69166: 39% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(2)
1:21.654 aoe t arcane_barrage Fluffy_Pillow 30085.2/69166: 43% mana arcane_charge(4), crimson_chorus(3)
1:22.940 aoe s arcane_explosion Fluffy_Pillow 34630.8/69166: 50% mana crimson_chorus(3)
1:24.223 aoe s arcane_explosion Fluffy_Pillow 31405.6/69166: 45% mana arcane_charge, crimson_chorus(3)
1:25.510 aoe s arcane_explosion Fluffy_Pillow 28185.9/69166: 41% mana arcane_charge(2), crimson_chorus(3)
1:26.794 aoe s arcane_explosion Fluffy_Pillow 24962.1/69166: 36% mana arcane_charge(3), crimson_chorus(3)
1:28.081 aoe t arcane_barrage Fluffy_Pillow 21742.4/69166: 31% mana arcane_charge(4), crimson_chorus(3)
1:29.368 aoe s arcane_explosion Fluffy_Pillow 26289.3/69166: 38% mana crimson_chorus(3)
1:30.657 aoe s arcane_explosion Fluffy_Pillow 23072.4/69166: 33% mana arcane_charge
1:31.945 aoe s arcane_explosion Fluffy_Pillow 19854.1/69166: 29% mana arcane_charge(2)
1:33.231 aoe s arcane_explosion Fluffy_Pillow 16633.1/69166: 24% mana arcane_charge(3)
1:34.517 aoe t arcane_barrage Fluffy_Pillow 13412.0/69166: 19% mana arcane_charge(4)
1:35.805 aoe q arcane_orb Fluffy_Pillow 17960.4/69166: 26% mana
1:37.090 aoe t arcane_barrage Fluffy_Pillow 19237.9/69166: 28% mana arcane_charge(4)
1:38.376 aoe s arcane_explosion Fluffy_Pillow 23783.5/69166: 34% mana
1:39.662 aoe s arcane_explosion Fluffy_Pillow 20562.4/69166: 30% mana arcane_charge
1:40.950 aoe s arcane_explosion Fluffy_Pillow 17344.1/69166: 25% mana arcane_charge(2)
1:42.237 aoe r arcane_missiles Fluffy_Pillow 14124.5/69166: 20% mana arcane_charge(3), clearcasting
1:44.171 aoe s arcane_explosion Fluffy_Pillow 16799.8/69166: 24% mana arcane_charge(3)
1:45.459 aoe t arcane_barrage Fluffy_Pillow 13581.5/69166: 20% mana arcane_charge(4)
1:46.745 aoe s arcane_explosion Fluffy_Pillow 18127.1/69166: 26% mana
1:48.032 aoe s arcane_explosion Fluffy_Pillow 14907.4/69166: 22% mana arcane_charge
1:49.316 aoe r arcane_missiles Fluffy_Pillow 11683.6/69166: 17% mana arcane_charge(2), clearcasting
1:51.294 aoe s arcane_explosion Fluffy_Pillow 14419.8/69166: 21% mana arcane_charge(2)
1:52.580 aoe s arcane_explosion Fluffy_Pillow 11198.7/69166: 16% mana arcane_charge(3)
1:53.866 aoe t arcane_barrage Fluffy_Pillow 7977.7/69166: 12% mana arcane_charge(4)
1:55.152 aoe n touch_of_the_magi Fluffy_Pillow 12523.2/69166: 18% mana
1:56.439 aoe p rune_of_power Fluffy_Pillow 11803.6/69166: 17% mana arcane_charge(4)
1:57.725 aoe t arcane_barrage Fluffy_Pillow 13582.5/69166: 20% mana arcane_charge(4), rune_of_power
1:59.011 aoe q arcane_orb Fluffy_Pillow 18128.1/69166: 26% mana rune_of_power
2:00.298 aoe t arcane_barrage Fluffy_Pillow 19408.4/69166: 28% mana arcane_charge(4), rune_of_power
2:01.585 aoe s arcane_explosion Fluffy_Pillow 23955.3/69166: 35% mana rune_of_power, crimson_chorus
2:02.874 aoe s arcane_explosion Fluffy_Pillow 20738.4/69166: 30% mana arcane_charge, rune_of_power, crimson_chorus
2:04.160 aoe s arcane_explosion Fluffy_Pillow 17517.4/69166: 25% mana arcane_charge(2), rune_of_power, crimson_chorus
2:05.446 aoe r arcane_missiles Fluffy_Pillow 14296.3/69166: 21% mana arcane_charge(3), clearcasting, rune_of_power, crimson_chorus
2:07.391 aoe s arcane_explosion Fluffy_Pillow 16986.9/69166: 25% mana arcane_charge(3), rune_of_power, crimson_chorus
2:08.676 aoe t arcane_barrage Fluffy_Pillow 13764.4/69166: 20% mana arcane_charge(4), rune_of_power, crimson_chorus
2:09.964 aoe s arcane_explosion Fluffy_Pillow 18312.8/69166: 26% mana crimson_chorus
2:11.249 aoe s arcane_explosion Fluffy_Pillow 15090.3/69166: 22% mana arcane_charge, crimson_chorus(2)
2:12.536 aoe s arcane_explosion Fluffy_Pillow 11870.6/69166: 17% mana arcane_charge(2), crimson_chorus(2)
2:13.824 aoe s arcane_explosion Fluffy_Pillow 8652.4/69166: 13% mana arcane_charge(3), crimson_chorus(2)
2:15.109 aoe o arcane_power Fluffy_Pillow 5429.9/69166: 8% mana arcane_charge(4), clearcasting, crimson_chorus(2)
2:15.109 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 5429.9/69166: 8% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2)
2:15.109 aoe r arcane_missiles Fluffy_Pillow 5429.9/69166: 8% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.048 aoe t arcane_barrage Fluffy_Pillow 8112.2/69166: 12% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.334 aoe s arcane_explosion Fluffy_Pillow 12657.7/69166: 18% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.619 aoe s arcane_explosion Fluffy_Pillow 11935.3/69166: 17% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.906 shared_cds v use_mana_gem arcane 11215.6/69166: 16% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
2:20.906 aoe r arcane_missiles Fluffy_Pillow 18132.2/69166: 26% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
2:22.777 aoe s arcane_explosion Fluffy_Pillow 20720.4/69166: 30% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:24.064 aoe s arcane_explosion Fluffy_Pillow 20000.7/69166: 29% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:25.350 aoe t arcane_barrage Fluffy_Pillow 19279.6/69166: 28% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:26.637 aoe q arcane_orb Fluffy_Pillow 23826.6/69166: 34% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:27.925 aoe t arcane_barrage Fluffy_Pillow 25358.3/69166: 37% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
2:29.212 aoe s arcane_explosion Fluffy_Pillow 29905.3/69166: 43% mana arcane_power, crimson_chorus(3), gladiators_badge
2:30.501 aoe s arcane_explosion Fluffy_Pillow 29188.3/69166: 42% mana arcane_charge, crimson_chorus(3)
2:31.788 aoe s arcane_explosion Fluffy_Pillow 25968.7/69166: 38% mana arcane_charge(2)
2:33.075 aoe s arcane_explosion Fluffy_Pillow 22749.0/69166: 33% mana arcane_charge(3)
2:34.363 aoe r arcane_missiles Fluffy_Pillow 19530.7/69166: 28% mana arcane_charge(4), clearcasting
2:36.404 aoe t arcane_barrage Fluffy_Pillow 22354.1/69166: 32% mana arcane_charge(4)
2:37.691 aoe s arcane_explosion Fluffy_Pillow 26901.0/69166: 39% mana
2:38.977 aoe s arcane_explosion Fluffy_Pillow 23679.9/69166: 34% mana arcane_charge
2:40.264 aoe s arcane_explosion Fluffy_Pillow 20460.3/69166: 30% mana arcane_charge(2)
2:41.551 aoe s arcane_explosion Fluffy_Pillow 17240.6/69166: 25% mana arcane_charge(3)
2:42.838 aoe t arcane_barrage Fluffy_Pillow 14020.9/69166: 20% mana arcane_charge(4)
2:44.125 aoe n touch_of_the_magi Fluffy_Pillow 18567.9/69166: 27% mana
2:45.414 aoe p rune_of_power Fluffy_Pillow 17851.0/69166: 26% mana arcane_charge(4)
2:46.702 aoe t arcane_barrage Fluffy_Pillow 19632.7/69166: 28% mana arcane_charge(4), rune_of_power
2:47.988 aoe q arcane_orb Fluffy_Pillow 24178.2/69166: 35% mana rune_of_power
2:49.275 aoe t arcane_barrage Fluffy_Pillow 25458.6/69166: 37% mana arcane_charge(4), rune_of_power
2:50.561 aoe s arcane_explosion Fluffy_Pillow 30004.1/69166: 43% mana rune_of_power
2:51.848 aoe s arcane_explosion Fluffy_Pillow 26784.5/69166: 39% mana arcane_charge, rune_of_power
2:53.133 aoe s arcane_explosion Fluffy_Pillow 23562.0/69166: 34% mana arcane_charge(2), rune_of_power
2:54.420 aoe s arcane_explosion Fluffy_Pillow 20342.4/69166: 29% mana arcane_charge(3), rune_of_power
2:55.706 aoe r arcane_missiles Fluffy_Pillow 17121.3/69166: 25% mana arcane_charge(4), clearcasting, rune_of_power
2:57.636 aoe t arcane_barrage Fluffy_Pillow 19791.1/69166: 29% mana arcane_charge(4), rune_of_power
2:58.923 aoe s arcane_explosion Fluffy_Pillow 24338.0/69166: 35% mana
3:00.209 aoe s arcane_explosion Fluffy_Pillow 21117.0/69166: 31% mana arcane_charge
3:01.495 aoe s arcane_explosion Fluffy_Pillow 17895.9/69166: 26% mana arcane_charge(2)
3:02.779 aoe s arcane_explosion Fluffy_Pillow 14672.1/69166: 21% mana arcane_charge(3), crimson_chorus
3:04.064 aoe t arcane_barrage Fluffy_Pillow 11449.7/69166: 17% mana arcane_charge(4), crimson_chorus
3:05.351 aoe s arcane_explosion Fluffy_Pillow 15996.6/69166: 23% mana crimson_chorus
3:06.635 aoe s arcane_explosion Fluffy_Pillow 12772.8/69166: 18% mana arcane_charge, crimson_chorus
3:07.921 aoe s arcane_explosion Fluffy_Pillow 9551.7/69166: 14% mana arcane_charge(2), crimson_chorus
3:09.208 aoe s arcane_explosion Fluffy_Pillow 6332.1/69166: 9% mana arcane_charge(3), crimson_chorus
3:10.495 aoe r arcane_missiles Fluffy_Pillow 3112.4/69166: 4% mana arcane_charge(4), clearcasting, crimson_chorus
3:12.352 aoe t arcane_barrage Fluffy_Pillow 5681.2/69166: 8% mana arcane_charge(4), crimson_chorus(2)
3:13.636 aoe q arcane_orb Fluffy_Pillow 10224.0/69166: 15% mana crimson_chorus(2)
3:14.922 aoe t arcane_barrage Fluffy_Pillow 11502.9/69166: 17% mana arcane_charge(4), crimson_chorus(2)
3:16.210 aoe s arcane_explosion Fluffy_Pillow 16051.3/69166: 23% mana crimson_chorus(2)
3:17.493 aoe s arcane_explosion Fluffy_Pillow 12826.1/69166: 19% mana arcane_charge, crimson_chorus(2)
3:18.779 aoe s arcane_explosion Fluffy_Pillow 9605.0/69166: 14% mana arcane_charge(2), crimson_chorus(2)
3:20.065 aoe s arcane_explosion Fluffy_Pillow 6384.0/69166: 9% mana arcane_charge(3), crimson_chorus(2)
3:21.352 aoe t arcane_barrage Fluffy_Pillow 3164.3/69166: 5% mana arcane_charge(4), crimson_chorus(2)
3:22.639 aoe s arcane_explosion Fluffy_Pillow 7711.2/69166: 11% mana crimson_chorus(3)
3:23.925 aoe u evocation arcane 4490.2/69166: 6% mana arcane_charge, crimson_chorus(3)
3:28.200 aoe s arcane_explosion Fluffy_Pillow 63239.8/69166: 91% mana arcane_charge, crimson_chorus(3)
3:29.486 aoe r arcane_missiles Fluffy_Pillow 60018.7/69166: 87% mana arcane_charge(2), clearcasting, crimson_chorus(3)
3:31.552 aoe n touch_of_the_magi Fluffy_Pillow 62876.6/69166: 91% mana arcane_charge(2)
3:32.838 aoe p rune_of_power Fluffy_Pillow 62155.6/69166: 90% mana arcane_charge(4)
3:34.123 aoe t arcane_barrage Fluffy_Pillow 63933.1/69166: 92% mana arcane_charge(4), rune_of_power
3:35.407 aoe q arcane_orb Fluffy_Pillow 68475.9/69166: 99% mana rune_of_power
3:36.694 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana arcane_charge(4), rune_of_power
3:37.981 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana rune_of_power
3:39.267 aoe s arcane_explosion Fluffy_Pillow 65944.7/69166: 95% mana arcane_charge, rune_of_power
3:40.555 aoe s arcane_explosion Fluffy_Pillow 62726.4/69166: 91% mana arcane_charge(2), rune_of_power
3:41.842 aoe s arcane_explosion Fluffy_Pillow 59506.7/69166: 86% mana arcane_charge(3), rune_of_power
3:43.129 aoe t arcane_barrage Fluffy_Pillow 56287.0/69166: 81% mana arcane_charge(4), rune_of_power
3:44.418 aoe s arcane_explosion Fluffy_Pillow 60836.7/69166: 88% mana rune_of_power
3:45.704 aoe s arcane_explosion Fluffy_Pillow 57615.7/69166: 83% mana arcane_charge, rune_of_power
3:46.990 aoe s arcane_explosion Fluffy_Pillow 54394.6/69166: 79% mana arcane_charge(2)
3:48.277 aoe s arcane_explosion Fluffy_Pillow 51174.9/69166: 74% mana arcane_charge(3)
3:49.563 aoe t arcane_barrage Fluffy_Pillow 47953.9/69166: 69% mana arcane_charge(4)
3:50.851 aoe s arcane_explosion Fluffy_Pillow 52502.2/69166: 76% mana
3:52.139 aoe s arcane_explosion Fluffy_Pillow 49283.9/69166: 71% mana arcane_charge
3:53.426 aoe s arcane_explosion Fluffy_Pillow 46064.3/69166: 67% mana arcane_charge(2)
3:54.712 aoe s arcane_explosion Fluffy_Pillow 42843.2/69166: 62% mana arcane_charge(3)
3:55.998 aoe r arcane_missiles Fluffy_Pillow 39622.1/69166: 57% mana arcane_charge(4), clearcasting
3:58.078 aoe t arcane_barrage Fluffy_Pillow 42499.4/69166: 61% mana arcane_charge(4)
3:59.364 aoe q arcane_orb Fluffy_Pillow 47045.0/69166: 68% mana
4:00.652 aoe t arcane_barrage Fluffy_Pillow 48326.7/69166: 70% mana arcane_charge(4)
4:01.938 aoe s arcane_explosion Fluffy_Pillow 52872.3/69166: 76% mana
4:03.225 aoe r arcane_missiles Fluffy_Pillow 49652.6/69166: 72% mana arcane_charge, clearcasting, crimson_chorus
4:05.226 aoe s arcane_explosion Fluffy_Pillow 52420.6/69166: 76% mana arcane_charge, crimson_chorus
4:06.512 aoe s arcane_explosion Fluffy_Pillow 49199.6/69166: 71% mana arcane_charge(2), crimson_chorus
4:07.798 aoe s arcane_explosion Fluffy_Pillow 45978.5/69166: 66% mana arcane_charge(3), crimson_chorus
4:09.084 aoe t arcane_barrage Fluffy_Pillow 42757.5/69166: 62% mana arcane_charge(4), crimson_chorus
4:10.371 aoe s arcane_explosion Fluffy_Pillow 47304.4/69166: 68% mana crimson_chorus
4:11.657 aoe s arcane_explosion Fluffy_Pillow 44083.3/69166: 64% mana arcane_charge, crimson_chorus
4:12.943 aoe s arcane_explosion Fluffy_Pillow 40862.3/69166: 59% mana arcane_charge(2), crimson_chorus(2)
4:14.230 aoe s arcane_explosion Fluffy_Pillow 37642.6/69166: 54% mana arcane_charge(3), crimson_chorus(2)
4:15.515 aoe t arcane_barrage Fluffy_Pillow 34420.2/69166: 50% mana arcane_charge(4), crimson_chorus(2)
4:16.803 aoe s arcane_explosion Fluffy_Pillow 38968.5/69166: 56% mana crimson_chorus(2)
4:18.090 aoe n touch_of_the_magi Fluffy_Pillow 35748.8/69166: 52% mana arcane_charge, crimson_chorus(2)
4:19.376 aoe o arcane_power Fluffy_Pillow 35027.8/69166: 51% mana arcane_charge(4), crimson_chorus(2)
4:19.376 shared_cds x berserking Fluffy_Pillow 35027.8/69166: 51% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:19.376 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 35027.8/69166: 51% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:19.376 aoe t arcane_barrage Fluffy_Pillow 35027.8/69166: 51% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.546 aoe q arcane_orb Fluffy_Pillow 39412.9/69166: 57% mana berserking, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.716 shared_cds v use_mana_gem arcane 40781.4/69166: 59% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.716 aoe t arcane_barrage Fluffy_Pillow 47697.9/69166: 69% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.886 aoe s arcane_explosion Fluffy_Pillow 52083.0/69166: 75% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:24.054 aoe s arcane_explosion Fluffy_Pillow 51198.8/69166: 74% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.224 aoe s arcane_explosion Fluffy_Pillow 50317.2/69166: 73% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.393 aoe s arcane_explosion Fluffy_Pillow 49434.3/69166: 71% mana berserking, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.562 aoe t arcane_barrage Fluffy_Pillow 48551.4/69166: 70% mana berserking, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:28.731 aoe s arcane_explosion Fluffy_Pillow 52935.1/69166: 77% mana berserking, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:29.900 aoe s arcane_explosion Fluffy_Pillow 52052.2/69166: 75% mana berserking, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:31.070 aoe s arcane_explosion Fluffy_Pillow 51170.7/69166: 74% mana berserking, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:32.239 aoe s arcane_explosion Fluffy_Pillow 50287.8/69166: 73% mana arcane_charge(3), arcane_power, gladiators_badge
4:33.525 aoe p rune_of_power Fluffy_Pillow 49566.8/69166: 72% mana arcane_charge(4), arcane_power, gladiators_badge
4:34.812 aoe t arcane_barrage Fluffy_Pillow 51347.1/69166: 74% mana arcane_charge(4), rune_of_power
4:36.099 aoe s arcane_explosion Fluffy_Pillow 55894.0/69166: 81% mana rune_of_power
4:37.387 aoe s arcane_explosion Fluffy_Pillow 52675.7/69166: 76% mana arcane_charge, rune_of_power
4:38.672 aoe r arcane_missiles Fluffy_Pillow 49453.3/69166: 71% mana arcane_charge(2), clearcasting, rune_of_power
4:40.465 aoe s arcane_explosion Fluffy_Pillow 51933.6/69166: 75% mana arcane_charge(2), rune_of_power
4:41.751 aoe s arcane_explosion Fluffy_Pillow 48712.5/69166: 70% mana arcane_charge(3), rune_of_power
4:43.037 aoe t arcane_barrage Fluffy_Pillow 45491.5/69166: 66% mana arcane_charge(4), rune_of_power
4:44.322 aoe q arcane_orb Fluffy_Pillow 50035.7/69166: 72% mana rune_of_power
4:45.608 aoe t arcane_barrage Fluffy_Pillow 51314.6/69166: 74% mana arcane_charge(4), rune_of_power
4:46.894 aoe s arcane_explosion Fluffy_Pillow 55860.2/69166: 81% mana
4:48.181 aoe s arcane_explosion Fluffy_Pillow 52640.5/69166: 76% mana arcane_charge
4:49.468 aoe r arcane_missiles Fluffy_Pillow 49420.8/69166: 71% mana arcane_charge(2), clearcasting
4:51.485 aoe s arcane_explosion Fluffy_Pillow 52211.0/69166: 75% mana arcane_charge(2)
4:52.772 aoe s arcane_explosion Fluffy_Pillow 48991.3/69166: 71% mana arcane_charge(3)
4:54.057 aoe t arcane_barrage Fluffy_Pillow 45768.8/69166: 66% mana arcane_charge(4)
4:55.343 aoe s arcane_explosion Fluffy_Pillow 50314.4/69166: 73% mana
4:56.630 aoe s arcane_explosion Fluffy_Pillow 47094.7/69166: 68% mana arcane_charge
4:57.916 aoe s arcane_explosion Fluffy_Pillow 43873.7/69166: 63% mana arcane_charge(2)
4:59.202 aoe s arcane_explosion Fluffy_Pillow 40652.6/69166: 59% mana arcane_charge(3)
5:00.489 aoe t arcane_barrage Fluffy_Pillow 37433.0/69166: 54% mana arcane_charge(4)
5:01.775 aoe s arcane_explosion Fluffy_Pillow 41978.5/69166: 61% mana

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 2027 1931 1517
Intellect 450 -3 1792 1612 1089 (46)
Spirit 0 0 0 0 0
Health 40540 38620 0
Mana 69166 69166 0
Spell Power 1792 1612 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

dark_iron_dwarf : 8960 dps, 4582 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8960.1 8960.1 16.3 / 0.182% 1062.6 / 11.9% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2042.3 1936.0 Mana 0.00% 48.4 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
dark_iron_dwarf 8960
Arcane Barrage 3777 42.2% 50.0 6.02sec 22715 18363 Direct 149.9 6414 13235 7583 17.1%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.04 149.95 0.00 0.00 1.2370 0.0000 1136683.87 1136683.87 0.00% 18362.64 18362.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.87% 124.26 91 158 6414.38 2171 33841 6407.51 5586 7246 796842 796842 0.00%
crit 17.13% 25.69 9 42 13235.09 4342 67681 13205.83 6579 19075 339842 339842 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.04
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 909 1819 1047 15.0%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1046.16 1046.16 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.97% 0.85 0 1 909.49 909 909 772.82 0 909 773 773 0.00%
crit 15.03% 0.15 0 1 1818.98 1819 1819 273.33 0 1819 273 273 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2944 32.8% 129.5 2.29sec 6833 5540 Direct 388.4 1930 3955 2278 17.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.46 388.37 0.00 0.00 1.2333 0.0000 884590.85 884590.85 0.00% 5540.47 5540.47
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.84% 321.71 237 413 1930.44 1451 3934 1931.02 1797 2067 620943 620943 0.00%
crit 17.16% 66.66 42 99 3954.58 2902 7867 3955.76 3392 4647 263648 263648 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.46
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1009 11.3% 24.5 11.94sec 12397 6527 Periodic 195.0 1323 2703 1555 16.8% 4.5%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.45 0.00 195.09 194.96 1.8992 0.2065 303153.87 303153.87 0.00% 6527.30 6527.30
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.15% 162.11 77 260 1322.67 1063 2883 1322.21 1130 1591 214392 214392 0.00%
crit 16.85% 32.85 11 59 2703.05 2127 5766 2701.02 2176 3702 88762 88762 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.46
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (604) 0.0% (6.7%) 12.7 24.36sec 14273 11511

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.72 0.00 0.00 0.00 1.2400 0.0000 0.00 0.00 0.00% 11510.72 11510.72

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.72
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 604 6.7% 38.1 24.35sec 4766 0 Direct 38.1 4034 8270 4767 17.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.09 38.09 0.00 0.00 0.0000 0.0000 181535.55 181535.55 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.69% 31.50 19 44 4034.29 2867 7774 4032.42 3260 4726 127014 127014 0.00%
crit 17.31% 6.59 1 16 8270.06 5735 15548 8299.61 5735 14668 54521 54521 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 13.9 1.80sec 514 0 Periodic 40.7 (42.6) 111 0 111 0.0% (0.0%) 4.5%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.87 0.00 40.70 40.70 0.0000 0.9871 4539.56 4539.56 0.00% 177.52 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.70 14 62 111.48 1 202 111.45 69 166 4540 4540 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 9.71sec 1349 0 Direct 1.9 1114 2231 1349 21.0%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.92 1.92 0.00 0.00 0.0000 0.0000 2592.15 2592.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.01% 1.52 0 3 1114.34 1093 1158 1040.19 0 1158 1692 1692 0.00%
crit 20.99% 0.40 0 3 2230.79 2185 2316 778.23 0 2316 900 900 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.3 14.41sec 529 0 Direct 20.3 452 905 529 17.0%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.25 20.25 0.00 0.00 0.0000 0.0000 10714.31 10714.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.00% 16.81 7 32 452.11 444 470 452.08 444 464 7599 7599 0.00%
crit 17.00% 3.44 0 9 904.75 887 941 875.86 0 941 3115 3115 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4188 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 105  / 14 0.2% 90.0 1.31sec 47 35 Direct 90.0 39 79 47 18.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4188.40 4188.40 0.00% 35.07 35.07
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.56% 73.41 61 83 39.18 30 50 39.18 38 41 2876 2876 0.00%
crit 18.44% 16.59 7 29 79.10 59 101 79.13 67 92 1313 1313 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (549) 0.0% (6.1%) 6.2 52.14sec 26616 20691

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 20691.28 20691.28

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 549 6.1% 6.2 52.03sec 26616 0 Direct 18.6 8906 0 8906 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 18.55 0.00 0.00 0.0000 0.0000 165075.03 165075.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.55 15 24 8906.45 475 46401 8885.19 5307 12875 165075 165075 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:15772.30
  • base_dd_max:15772.30
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
dark_iron_dwarf
Arcane Power 2.9 127.34sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 184.63sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.49 0.00 2.87 0.00 4.2030 0.7096 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dark_iron_dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.49
  • interrupt_if_expr:mana.pct>=85
Fireblood 2.9 127.34sec

Stats Details: Fireblood

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Fireblood

  • id:265221
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:265221
  • name:Fireblood
  • school:physical
  • tooltip:
  • description:Removes all poison, disease, curse, magic, and bleed effects and increases your $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] by ${{$265226s1=61}*3} and an additional {$265226s1=61} for each effect removed. Lasts {$265226d=8 seconds}. {$?s195710=false}[This effect shares a 30 sec cooldown with other similar effects.][]

Action Priority List

    shared_cds
    [x]:2.87
  • if_expr:buff.arcane_power.up
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dark_iron_dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dark_iron_dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 50.33sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2376 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.07
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 122.94sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dark_iron_dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.8 136.6 6.0sec 1.6sec 4.6sec 77.99% 0.00% 2.9 (3.9) 0.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 17.9s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.3s

Stack Uptimes

  • arcane_charge_1:20.59%
  • arcane_charge_2:17.71%
  • arcane_charge_3:16.93%
  • arcane_charge_4:22.77%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.3sec 127.3sec 14.7sec 14.05% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 139.8s
  • trigger_min/max:120.0s / 139.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.05%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.6 0.0 11.8sec 11.8sec 1.3sec 10.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.48%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.06% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.5s
  • trigger_min/max:60.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.95%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.77%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 209.7sec 209.7sec 4.2sec 0.68% 0.00% 1.9 (1.9) 0.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:184.6s / 234.7s
  • trigger_min/max:184.6s / 234.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:0.68%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Fireblood 2.9 0.0 127.3sec 127.3sec 7.9sec 7.59% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_fireblood
  • max_stacks:6
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:intellect
  • amount:183.00

Trigger Details

  • interval_min/max:120.0s / 139.8s
  • trigger_min/max:120.0s / 139.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • fireblood_1:7.59%

Spelldata

  • id:265226
  • name:Fireblood
  • tooltip:Increases $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] by $w1.
  • description:Increases $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] by {$s1=61}.
  • max_stacks:6
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Gladiator's Badge 3.9 0.0 86.8sec 86.8sec 14.6sec 19.02% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 139.8s
  • trigger_min/max:60.0s / 139.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.02%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 34.97% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 60.1s
  • trigger_min/max:12.0s / 60.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.97%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.90% 0.78% 5.65% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation220.43087.948356.366269.464151.462359.985
Rune of Power6.1760.00330.73838.91517.16377.960
Touch of the Magi4.8900.00025.78031.98514.83976.379
Arcane Power5.1830.00019.76215.1001.86834.734
Arcane Barrage3.5190.00314.070177.803138.054218.663
Arcane Orb4.2320.00019.80754.41530.42383.898

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
dark_iron_dwarf
mana_regen Mana 1048.93 406058.86 69.73% 387.12 9419.52 2.27%
Evocation Mana 22.49 25260.12 4.34% 1123.33 0.00 0.00%
Mana Gem Mana 2.74 18956.53 3.26% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.04 132021.64 22.67% 2638.57 6407.37 4.63%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1936.04 2042.25 15820.5 37218.9 2210.4 69165.7
Usage Type Count Total Avg RPE APR
dark_iron_dwarf
arcane_explosion Mana 129.5 591585.1 4569.7 4569.8 1.5
arcane_orb Mana 12.7 5789.7 455.3 455.2 31.4
touch_of_the_magi Mana 6.2 15496.0 2499.6 2498.5 10.7

Statistics & Data Analysis

Fight Length
dark_iron_dwarf Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
dark_iron_dwarf Damage Per Second
Count 1118
Mean 8960.09
Minimum 8187.45
Maximum 9833.73
Spread ( max - min ) 1646.28
Range [ ( max - min ) / 2 * 100% ] 9.19%
Standard Deviation 278.8144
5th Percentile 8507.67
95th Percentile 9433.74
( 95th Percentile - 5th Percentile ) 926.07
Mean Distribution
Standard Deviation 8.3386
95.00% Confidence Interval ( 8943.75 - 8976.43 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3720
0.1 Scale Factor Error with Delta=300 664
0.05 Scale Factor Error with Delta=300 2655
0.01 Scale Factor Error with Delta=300 66362
Priority Target DPS
dark_iron_dwarf Priority Target Damage Per Second
Count 1118
Mean 4582.26
Minimum 4066.76
Maximum 5321.41
Spread ( max - min ) 1254.65
Range [ ( max - min ) / 2 * 100% ] 13.69%
Standard Deviation 196.5951
5th Percentile 4281.22
95th Percentile 4918.30
( 95th Percentile - 5th Percentile ) 637.07
Mean Distribution
Standard Deviation 5.8797
95.00% Confidence Interval ( 4570.73 - 4593.78 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7072
0.1 Scale Factor Error with Delta=300 330
0.05 Scale Factor Error with Delta=300 1320
0.01 Scale Factor Error with Delta=300 32994
DPS(e)
dark_iron_dwarf Damage Per Second (Effective)
Count 1118
Mean 8960.09
Minimum 8187.45
Maximum 9833.73
Spread ( max - min ) 1646.28
Range [ ( max - min ) / 2 * 100% ] 9.19%
Damage
dark_iron_dwarf Damage
Count 1118
Mean 2689931.34
Minimum 1974359.99
Maximum 3283618.38
Spread ( max - min ) 1309258.39
Range [ ( max - min ) / 2 * 100% ] 24.34%
DTPS
dark_iron_dwarf Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
dark_iron_dwarf Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
dark_iron_dwarf Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
dark_iron_dwarf Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
dark_iron_dwarf Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
dark_iron_dwarf Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
dark_iron_dwarfTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
dark_iron_dwarf Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.07 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.72 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.46 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.46 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.04 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.49 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
x 2.87 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
y 3.92 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxytqtsssstsssstssssprtsrsrsstqtsrssrsvrtssrsstqtsrsssrtsnyprtqtsrsssrtsssrstqtsssstsssstsssstnptqtsssstsrsssoxytssrsstqtssrsstsssrvsrtnptqtsssstsssstsssstqtsssstsrssrstsnptqtsrsssrtssrssrtqtsssstsssstsssrstnoxytqtsssstsrsssvptsssstqtsssrstss

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask dark_iron_dwarf 69165.7/69166: 100% mana
Pre precombat U food dark_iron_dwarf 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana
0:01.288 aoe o arcane_power Fluffy_Pillow 66674.0/69166: 96% mana bloodlust, crimson_chorus
0:01.288 shared_cds w potion Fluffy_Pillow 66674.0/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:01.288 shared_cds x fireblood Fluffy_Pillow 66674.0/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.288 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66674.0/69166: 96% mana bloodlust, fireblood, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.288 aoe t arcane_barrage Fluffy_Pillow 66674.0/69166: 96% mana bloodlust, fireblood, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.279 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, fireblood, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.270 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, fireblood, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.261 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, fireblood, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.251 aoe s arcane_explosion Fluffy_Pillow 68035.2/69166: 98% mana bloodlust, fireblood, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.243 aoe s arcane_explosion Fluffy_Pillow 66907.4/69166: 97% mana bloodlust, fireblood, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.235 aoe s arcane_explosion Fluffy_Pillow 65779.7/69166: 95% mana bloodlust, fireblood, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.228 aoe t arcane_barrage Fluffy_Pillow 64653.3/69166: 93% mana bloodlust, fireblood, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.218 aoe s arcane_explosion Fluffy_Pillow 68789.4/69166: 99% mana bloodlust, fireblood, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.209 aoe s arcane_explosion Fluffy_Pillow 67660.3/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.200 aoe s arcane_explosion Fluffy_Pillow 66531.2/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.191 aoe s arcane_explosion Fluffy_Pillow 65402.0/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.183 aoe t arcane_barrage Fluffy_Pillow 64274.3/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.174 aoe s arcane_explosion Fluffy_Pillow 68411.8/69166: 99% mana bloodlust, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.164 aoe s arcane_explosion Fluffy_Pillow 67281.2/69166: 97% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.152 aoe s arcane_explosion Fluffy_Pillow 66148.0/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.141 aoe s arcane_explosion Fluffy_Pillow 65016.1/69166: 94% mana bloodlust, arcane_charge(3), crimson_chorus(2), potion_of_deathly_fixation
0:18.132 aoe p rune_of_power Fluffy_Pillow 61386.9/69166: 89% mana bloodlust, arcane_charge(4), clearcasting, crimson_chorus(2), potion_of_deathly_fixation
0:19.123 aoe r arcane_missiles Fluffy_Pillow 62757.8/69166: 91% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.633 aoe t arcane_barrage Fluffy_Pillow 64846.6/69166: 94% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.624 aoe s arcane_explosion Fluffy_Pillow 68984.1/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.613 aoe r arcane_missiles Fluffy_Pillow 65352.2/69166: 94% mana bloodlust, arcane_charge, clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.211 aoe s arcane_explosion Fluffy_Pillow 67562.7/69166: 98% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.203 aoe r arcane_missiles Fluffy_Pillow 63935.0/69166: 92% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.757 aoe s arcane_explosion Fluffy_Pillow 66084.6/69166: 96% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3)
0:27.748 aoe s arcane_explosion Fluffy_Pillow 62455.5/69166: 90% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3)
0:28.737 aoe t arcane_barrage Fluffy_Pillow 58823.6/69166: 85% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3)
0:29.726 aoe q arcane_orb Fluffy_Pillow 62958.3/69166: 91% mana bloodlust, rune_of_power, crimson_chorus(3)
0:30.715 aoe t arcane_barrage Fluffy_Pillow 63826.4/69166: 92% mana bloodlust, arcane_charge(4), rune_of_power
0:31.705 aoe s arcane_explosion Fluffy_Pillow 67962.5/69166: 98% mana bloodlust
0:32.697 aoe r arcane_missiles Fluffy_Pillow 64334.8/69166: 93% mana bloodlust, arcane_charge, clearcasting
0:34.283 aoe s arcane_explosion Fluffy_Pillow 66528.7/69166: 96% mana bloodlust, arcane_charge
0:35.274 aoe s arcane_explosion Fluffy_Pillow 62899.6/69166: 91% mana bloodlust, arcane_charge(2)
0:36.266 aoe r arcane_missiles Fluffy_Pillow 59271.8/69166: 86% mana bloodlust, arcane_charge(3), clearcasting
0:37.927 aoe s arcane_explosion Fluffy_Pillow 61569.5/69166: 89% mana bloodlust, arcane_charge(3)
0:38.918 shared_cds v use_mana_gem dark_iron_dwarf 57940.4/69166: 84% mana bloodlust, arcane_charge(4), clearcasting
0:38.918 aoe r arcane_missiles Fluffy_Pillow 64857.0/69166: 94% mana bloodlust, arcane_charge(4), clearcasting
0:40.502 aoe t arcane_barrage Fluffy_Pillow 67048.1/69166: 97% mana bloodlust, arcane_charge(4)
0:41.493 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana
0:42.780 aoe s arcane_explosion Fluffy_Pillow 65946.0/69166: 95% mana arcane_charge
0:44.067 aoe r arcane_missiles Fluffy_Pillow 62726.4/69166: 91% mana arcane_charge(2), clearcasting
0:45.918 aoe s arcane_explosion Fluffy_Pillow 65286.9/69166: 94% mana arcane_charge(2)
0:47.204 aoe s arcane_explosion Fluffy_Pillow 62065.8/69166: 90% mana arcane_charge(3)
0:48.489 aoe t arcane_barrage Fluffy_Pillow 58843.4/69166: 85% mana arcane_charge(4)
0:49.776 aoe q arcane_orb Fluffy_Pillow 63390.3/69166: 92% mana
0:51.064 aoe t arcane_barrage Fluffy_Pillow 64672.0/69166: 94% mana arcane_charge(4)
0:52.352 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana
0:53.637 aoe r arcane_missiles Fluffy_Pillow 65943.3/69166: 95% mana arcane_charge, clearcasting
0:55.730 aoe s arcane_explosion Fluffy_Pillow 68838.5/69166: 100% mana arcane_charge
0:57.016 aoe s arcane_explosion Fluffy_Pillow 65617.5/69166: 95% mana arcane_charge(2)
0:58.302 aoe s arcane_explosion Fluffy_Pillow 62396.4/69166: 90% mana arcane_charge(3)
0:59.591 aoe r arcane_missiles Fluffy_Pillow 59179.5/69166: 86% mana arcane_charge(4), clearcasting
1:01.503 aoe t arcane_barrage Fluffy_Pillow 61824.4/69166: 89% mana arcane_charge(4), crimson_chorus
1:02.789 aoe s arcane_explosion Fluffy_Pillow 66370.0/69166: 96% mana crimson_chorus
1:04.076 aoe n touch_of_the_magi Fluffy_Pillow 63150.3/69166: 91% mana arcane_charge, clearcasting, crimson_chorus
1:05.362 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 62429.3/69166: 90% mana arcane_charge(4), clearcasting, crimson_chorus
1:05.362 aoe p rune_of_power Fluffy_Pillow 62429.3/69166: 90% mana arcane_charge(4), clearcasting, crimson_chorus, gladiators_badge
1:06.649 aoe r arcane_missiles Fluffy_Pillow 64209.6/69166: 93% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus, gladiators_badge
1:08.575 aoe t arcane_barrage Fluffy_Pillow 66873.9/69166: 97% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:09.862 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana rune_of_power, crimson_chorus, gladiators_badge
1:11.147 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
1:12.434 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana rune_of_power, crimson_chorus(2), gladiators_badge
1:13.720 aoe r arcane_missiles Fluffy_Pillow 65944.7/69166: 95% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
1:15.777 aoe s arcane_explosion Fluffy_Pillow 68790.1/69166: 99% mana arcane_charge, rune_of_power, crimson_chorus(2), gladiators_badge
1:17.063 aoe s arcane_explosion Fluffy_Pillow 65569.1/69166: 95% mana arcane_charge(2), rune_of_power, crimson_chorus(2), gladiators_badge
1:18.350 aoe s arcane_explosion Fluffy_Pillow 62349.4/69166: 90% mana arcane_charge(3), rune_of_power, crimson_chorus(2), gladiators_badge
1:19.636 aoe r arcane_missiles Fluffy_Pillow 59128.3/69166: 85% mana arcane_charge(4), clearcasting, crimson_chorus(2), gladiators_badge
1:21.715 aoe t arcane_barrage Fluffy_Pillow 62004.3/69166: 90% mana arcane_charge(4), crimson_chorus(3)
1:23.002 aoe s arcane_explosion Fluffy_Pillow 66551.2/69166: 96% mana crimson_chorus(3)
1:24.288 aoe s arcane_explosion Fluffy_Pillow 63330.2/69166: 92% mana arcane_charge, crimson_chorus(3)
1:25.575 aoe s arcane_explosion Fluffy_Pillow 60110.5/69166: 87% mana arcane_charge(2), crimson_chorus(3)
1:26.862 aoe r arcane_missiles Fluffy_Pillow 56890.8/69166: 82% mana arcane_charge(3), clearcasting, crimson_chorus(3)
1:28.747 aoe s arcane_explosion Fluffy_Pillow 59498.3/69166: 86% mana arcane_charge(3), crimson_chorus(3)
1:30.033 aoe t arcane_barrage Fluffy_Pillow 56277.3/69166: 81% mana arcane_charge(4), crimson_chorus(3)
1:31.320 aoe q arcane_orb Fluffy_Pillow 60824.2/69166: 88% mana
1:32.605 aoe t arcane_barrage Fluffy_Pillow 62101.8/69166: 90% mana arcane_charge(4)
1:33.892 aoe s arcane_explosion Fluffy_Pillow 66648.8/69166: 96% mana
1:35.180 aoe s arcane_explosion Fluffy_Pillow 63430.5/69166: 92% mana arcane_charge
1:36.466 aoe s arcane_explosion Fluffy_Pillow 60209.4/69166: 87% mana arcane_charge(2)
1:37.751 aoe s arcane_explosion Fluffy_Pillow 56987.0/69166: 82% mana arcane_charge(3)
1:39.037 aoe t arcane_barrage Fluffy_Pillow 53765.9/69166: 78% mana arcane_charge(4)
1:40.323 aoe s arcane_explosion Fluffy_Pillow 58311.5/69166: 84% mana
1:41.611 aoe s arcane_explosion Fluffy_Pillow 55093.2/69166: 80% mana arcane_charge
1:42.897 aoe s arcane_explosion Fluffy_Pillow 51872.1/69166: 75% mana arcane_charge(2)
1:44.185 aoe s arcane_explosion Fluffy_Pillow 48653.8/69166: 70% mana arcane_charge(3)
1:45.471 aoe t arcane_barrage Fluffy_Pillow 45432.8/69166: 66% mana arcane_charge(4)
1:46.757 aoe s arcane_explosion Fluffy_Pillow 49978.4/69166: 72% mana
1:48.042 aoe s arcane_explosion Fluffy_Pillow 46755.9/69166: 68% mana arcane_charge
1:49.329 aoe s arcane_explosion Fluffy_Pillow 43536.2/69166: 63% mana arcane_charge(2)
1:50.617 aoe s arcane_explosion Fluffy_Pillow 40317.9/69166: 58% mana arcane_charge(3)
1:51.904 aoe t arcane_barrage Fluffy_Pillow 37098.3/69166: 54% mana arcane_charge(4)
1:53.191 aoe n touch_of_the_magi Fluffy_Pillow 41645.2/69166: 60% mana
1:54.476 aoe p rune_of_power Fluffy_Pillow 40922.8/69166: 59% mana arcane_charge(4)
1:55.764 aoe t arcane_barrage Fluffy_Pillow 42704.5/69166: 62% mana arcane_charge(4), rune_of_power
1:57.051 aoe q arcane_orb Fluffy_Pillow 47251.4/69166: 68% mana rune_of_power
1:58.337 aoe t arcane_barrage Fluffy_Pillow 48530.4/69166: 70% mana arcane_charge(4), rune_of_power
1:59.622 aoe s arcane_explosion Fluffy_Pillow 53074.6/69166: 77% mana rune_of_power
2:00.909 aoe s arcane_explosion Fluffy_Pillow 49854.9/69166: 72% mana arcane_charge, rune_of_power
2:02.197 aoe s arcane_explosion Fluffy_Pillow 46636.6/69166: 67% mana arcane_charge(2), rune_of_power, crimson_chorus
2:03.483 aoe s arcane_explosion Fluffy_Pillow 43415.6/69166: 63% mana arcane_charge(3), rune_of_power, crimson_chorus
2:04.770 aoe t arcane_barrage Fluffy_Pillow 40195.9/69166: 58% mana arcane_charge(4), rune_of_power, crimson_chorus
2:06.057 aoe s arcane_explosion Fluffy_Pillow 44742.8/69166: 65% mana rune_of_power, crimson_chorus
2:07.345 aoe r arcane_missiles Fluffy_Pillow 41524.5/69166: 60% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus
2:09.365 aoe s arcane_explosion Fluffy_Pillow 44318.8/69166: 64% mana arcane_charge, crimson_chorus
2:10.652 aoe s arcane_explosion Fluffy_Pillow 41099.2/69166: 59% mana arcane_charge(2), crimson_chorus
2:11.938 aoe s arcane_explosion Fluffy_Pillow 37878.1/69166: 55% mana arcane_charge(3), crimson_chorus(2)
2:13.224 aoe o arcane_power Fluffy_Pillow 34657.0/69166: 50% mana arcane_charge(4), crimson_chorus(2)
2:13.224 shared_cds x fireblood Fluffy_Pillow 34657.0/69166: 50% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
2:13.224 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 34657.0/69166: 50% mana fireblood, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
2:13.224 aoe t arcane_barrage Fluffy_Pillow 34657.0/69166: 50% mana fireblood, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.512 aoe s arcane_explosion Fluffy_Pillow 39205.4/69166: 57% mana fireblood, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.798 aoe s arcane_explosion Fluffy_Pillow 38484.3/69166: 56% mana fireblood, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.083 aoe r arcane_missiles Fluffy_Pillow 37761.9/69166: 55% mana fireblood, arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.060 aoe s arcane_explosion Fluffy_Pillow 40496.7/69166: 59% mana fireblood, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.347 aoe s arcane_explosion Fluffy_Pillow 39777.0/69166: 58% mana fireblood, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:21.633 aoe t arcane_barrage Fluffy_Pillow 39056.0/69166: 56% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:22.918 aoe q arcane_orb Fluffy_Pillow 43600.2/69166: 63% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:24.203 aoe t arcane_barrage Fluffy_Pillow 45127.7/69166: 65% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:25.489 aoe s arcane_explosion Fluffy_Pillow 49673.3/69166: 72% mana arcane_power, crimson_chorus(3), gladiators_badge
2:26.777 aoe s arcane_explosion Fluffy_Pillow 48955.0/69166: 71% mana arcane_charge, arcane_power, crimson_chorus(3), gladiators_badge
2:28.065 aoe r arcane_missiles Fluffy_Pillow 48236.7/69166: 70% mana arcane_charge(2), arcane_power, clearcasting, crimson_chorus(3), gladiators_badge
2:30.031 aoe s arcane_explosion Fluffy_Pillow 50956.3/69166: 74% mana arcane_charge(2), crimson_chorus(3)
2:31.317 aoe s arcane_explosion Fluffy_Pillow 47735.2/69166: 69% mana arcane_charge(3)
2:32.605 aoe t arcane_barrage Fluffy_Pillow 44516.9/69166: 64% mana arcane_charge(4)
2:33.892 aoe s arcane_explosion Fluffy_Pillow 49063.9/69166: 71% mana
2:35.178 aoe s arcane_explosion Fluffy_Pillow 45842.8/69166: 66% mana arcane_charge
2:36.464 aoe s arcane_explosion Fluffy_Pillow 42621.8/69166: 62% mana arcane_charge(2)
2:37.753 aoe r arcane_missiles Fluffy_Pillow 39404.9/69166: 57% mana arcane_charge(3), clearcasting
2:39.727 shared_cds v use_mana_gem dark_iron_dwarf 42135.5/69166: 61% mana arcane_charge(3)
2:39.727 aoe s arcane_explosion Fluffy_Pillow 49052.1/69166: 71% mana arcane_charge(3)
2:41.013 aoe r arcane_missiles Fluffy_Pillow 45831.1/69166: 66% mana arcane_charge(4), clearcasting
2:43.048 aoe t arcane_barrage Fluffy_Pillow 48646.1/69166: 70% mana arcane_charge(4)
2:44.334 aoe n touch_of_the_magi Fluffy_Pillow 53191.7/69166: 77% mana
2:45.619 aoe p rune_of_power Fluffy_Pillow 52469.2/69166: 76% mana arcane_charge(4)
2:46.906 aoe t arcane_barrage Fluffy_Pillow 54249.6/69166: 78% mana arcane_charge(4), rune_of_power
2:48.192 aoe q arcane_orb Fluffy_Pillow 58795.1/69166: 85% mana rune_of_power
2:49.477 aoe t arcane_barrage Fluffy_Pillow 60072.7/69166: 87% mana arcane_charge(4), rune_of_power
2:50.764 aoe s arcane_explosion Fluffy_Pillow 64619.6/69166: 93% mana rune_of_power
2:52.049 aoe s arcane_explosion Fluffy_Pillow 61397.2/69166: 89% mana arcane_charge, rune_of_power
2:53.336 aoe s arcane_explosion Fluffy_Pillow 58177.5/69166: 84% mana arcane_charge(2), rune_of_power
2:54.622 aoe s arcane_explosion Fluffy_Pillow 54956.5/69166: 79% mana arcane_charge(3), rune_of_power
2:55.907 aoe t arcane_barrage Fluffy_Pillow 51734.0/69166: 75% mana arcane_charge(4), rune_of_power
2:57.192 aoe s arcane_explosion Fluffy_Pillow 56278.2/69166: 81% mana rune_of_power
2:58.479 aoe s arcane_explosion Fluffy_Pillow 53058.5/69166: 77% mana arcane_charge, rune_of_power
2:59.766 aoe s arcane_explosion Fluffy_Pillow 49838.9/69166: 72% mana arcane_charge(2)
3:01.054 aoe s arcane_explosion Fluffy_Pillow 46620.6/69166: 67% mana arcane_charge(3)
3:02.342 aoe t arcane_barrage Fluffy_Pillow 43402.3/69166: 63% mana arcane_charge(4), crimson_chorus
3:03.628 aoe s arcane_explosion Fluffy_Pillow 47947.8/69166: 69% mana crimson_chorus
3:04.914 aoe s arcane_explosion Fluffy_Pillow 44726.8/69166: 65% mana arcane_charge, crimson_chorus
3:06.200 aoe s arcane_explosion Fluffy_Pillow 41505.7/69166: 60% mana arcane_charge(2), crimson_chorus
3:07.485 aoe s arcane_explosion Fluffy_Pillow 38283.3/69166: 55% mana arcane_charge(3), crimson_chorus
3:08.773 aoe t arcane_barrage Fluffy_Pillow 35065.0/69166: 51% mana arcane_charge(4), crimson_chorus
3:10.057 aoe q arcane_orb Fluffy_Pillow 39607.8/69166: 57% mana crimson_chorus
3:11.343 aoe t arcane_barrage Fluffy_Pillow 40886.7/69166: 59% mana arcane_charge(4), crimson_chorus(2)
3:12.629 aoe s arcane_explosion Fluffy_Pillow 45432.3/69166: 66% mana crimson_chorus(2)
3:13.916 aoe s arcane_explosion Fluffy_Pillow 42212.6/69166: 61% mana arcane_charge, crimson_chorus(2)
3:15.202 aoe s arcane_explosion Fluffy_Pillow 38991.6/69166: 56% mana arcane_charge(2), crimson_chorus(2)
3:16.488 aoe s arcane_explosion Fluffy_Pillow 35770.5/69166: 52% mana arcane_charge(3), crimson_chorus(2)
3:17.776 aoe t arcane_barrage Fluffy_Pillow 32552.2/69166: 47% mana arcane_charge(4), crimson_chorus(2)
3:19.063 aoe s arcane_explosion Fluffy_Pillow 37099.2/69166: 54% mana crimson_chorus(2)
3:20.350 aoe r arcane_missiles Fluffy_Pillow 33879.5/69166: 49% mana arcane_charge, clearcasting, crimson_chorus(2)
3:22.392 aoe s arcane_explosion Fluffy_Pillow 36704.2/69166: 53% mana arcane_charge, crimson_chorus(3)
3:23.677 aoe s arcane_explosion Fluffy_Pillow 33481.8/69166: 48% mana arcane_charge(2), crimson_chorus(3)
3:24.965 aoe r arcane_missiles Fluffy_Pillow 30263.5/69166: 44% mana arcane_charge(3), clearcasting, crimson_chorus(3)
3:26.924 aoe s arcane_explosion Fluffy_Pillow 32973.4/69166: 48% mana arcane_charge(3), crimson_chorus(3)
3:28.211 aoe t arcane_barrage Fluffy_Pillow 29753.7/69166: 43% mana arcane_charge(4), crimson_chorus(3)
3:29.497 aoe s arcane_explosion Fluffy_Pillow 34299.3/69166: 50% mana crimson_chorus(3)
3:30.784 aoe n touch_of_the_magi Fluffy_Pillow 31079.6/69166: 45% mana arcane_charge, crimson_chorus(3)
3:32.069 aoe p rune_of_power Fluffy_Pillow 30357.2/69166: 44% mana arcane_charge(4)
3:33.355 aoe t arcane_barrage Fluffy_Pillow 32136.1/69166: 46% mana arcane_charge(4), rune_of_power
3:34.642 aoe q arcane_orb Fluffy_Pillow 36683.1/69166: 53% mana rune_of_power
3:35.928 aoe t arcane_barrage Fluffy_Pillow 37962.0/69166: 55% mana arcane_charge(4), rune_of_power
3:37.214 aoe s arcane_explosion Fluffy_Pillow 42507.6/69166: 61% mana rune_of_power
3:38.500 aoe r arcane_missiles Fluffy_Pillow 39286.6/69166: 57% mana arcane_charge, clearcasting, rune_of_power
3:40.479 aoe s arcane_explosion Fluffy_Pillow 42024.1/69166: 61% mana arcane_charge, rune_of_power
3:41.766 aoe s arcane_explosion Fluffy_Pillow 38804.5/69166: 56% mana arcane_charge(2), rune_of_power
3:43.052 aoe s arcane_explosion Fluffy_Pillow 35583.4/69166: 51% mana arcane_charge(3), rune_of_power
3:44.340 aoe r arcane_missiles Fluffy_Pillow 32365.1/69166: 47% mana arcane_charge(4), clearcasting, rune_of_power
3:46.159 aoe t arcane_barrage Fluffy_Pillow 34881.4/69166: 50% mana arcane_charge(4)
3:47.446 aoe s arcane_explosion Fluffy_Pillow 39428.3/69166: 57% mana
3:48.730 aoe s arcane_explosion Fluffy_Pillow 36204.5/69166: 52% mana arcane_charge
3:50.016 aoe r arcane_missiles Fluffy_Pillow 32983.4/69166: 48% mana arcane_charge(2), clearcasting
3:51.871 aoe s arcane_explosion Fluffy_Pillow 35549.5/69166: 51% mana arcane_charge(2)
3:53.157 aoe s arcane_explosion Fluffy_Pillow 32328.4/69166: 47% mana arcane_charge(3)
3:54.443 aoe r arcane_missiles Fluffy_Pillow 29107.4/69166: 42% mana arcane_charge(4), clearcasting
3:56.457 aoe t arcane_barrage Fluffy_Pillow 31893.4/69166: 46% mana arcane_charge(4)
3:57.743 aoe q arcane_orb Fluffy_Pillow 36438.9/69166: 53% mana
3:59.029 aoe t arcane_barrage Fluffy_Pillow 37717.9/69166: 55% mana arcane_charge(4)
4:00.316 aoe s arcane_explosion Fluffy_Pillow 42264.8/69166: 61% mana
4:01.603 aoe s arcane_explosion Fluffy_Pillow 39045.2/69166: 56% mana arcane_charge
4:02.890 aoe s arcane_explosion Fluffy_Pillow 35825.5/69166: 52% mana arcane_charge(2), crimson_chorus
4:04.177 aoe s arcane_explosion Fluffy_Pillow 32605.8/69166: 47% mana arcane_charge(3), crimson_chorus
4:05.462 aoe t arcane_barrage Fluffy_Pillow 29383.4/69166: 42% mana arcane_charge(4), crimson_chorus
4:06.748 aoe s arcane_explosion Fluffy_Pillow 33928.9/69166: 49% mana crimson_chorus
4:08.035 aoe s arcane_explosion Fluffy_Pillow 30709.3/69166: 44% mana arcane_charge, crimson_chorus
4:09.321 aoe s arcane_explosion Fluffy_Pillow 27488.2/69166: 40% mana arcane_charge(2), crimson_chorus
4:10.609 aoe s arcane_explosion Fluffy_Pillow 24269.9/69166: 35% mana arcane_charge(3), crimson_chorus
4:11.896 aoe t arcane_barrage Fluffy_Pillow 21050.2/69166: 30% mana arcane_charge(4), crimson_chorus(2)
4:13.182 aoe s arcane_explosion Fluffy_Pillow 25595.8/69166: 37% mana crimson_chorus(2)
4:14.470 aoe s arcane_explosion Fluffy_Pillow 22377.5/69166: 32% mana arcane_charge, crimson_chorus(2)
4:15.757 aoe s arcane_explosion Fluffy_Pillow 19157.8/69166: 28% mana arcane_charge(2), crimson_chorus(2)
4:17.042 aoe r arcane_missiles Fluffy_Pillow 15935.4/69166: 23% mana arcane_charge(3), clearcasting, crimson_chorus(2)
4:18.994 aoe s arcane_explosion Fluffy_Pillow 18635.6/69166: 27% mana arcane_charge(3), crimson_chorus(2)
4:20.279 aoe t arcane_barrage Fluffy_Pillow 15413.2/69166: 22% mana arcane_charge(4), crimson_chorus(2)
4:21.568 aoe n touch_of_the_magi Fluffy_Pillow 19962.9/69166: 29% mana crimson_chorus(2)
4:22.853 aoe o arcane_power Fluffy_Pillow 19240.5/69166: 28% mana arcane_charge(4), crimson_chorus(3)
4:22.853 shared_cds x fireblood Fluffy_Pillow 19240.5/69166: 28% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3)
4:22.853 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 19240.5/69166: 28% mana fireblood, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3)
4:22.853 aoe t arcane_barrage Fluffy_Pillow 19240.5/69166: 28% mana fireblood, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:24.138 aoe q arcane_orb Fluffy_Pillow 23784.7/69166: 34% mana fireblood, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.422 aoe t arcane_barrage Fluffy_Pillow 25310.8/69166: 37% mana fireblood, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.709 aoe s arcane_explosion Fluffy_Pillow 29857.8/69166: 43% mana fireblood, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.997 aoe s arcane_explosion Fluffy_Pillow 29139.5/69166: 42% mana fireblood, arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:29.284 aoe s arcane_explosion Fluffy_Pillow 28419.8/69166: 41% mana fireblood, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:30.572 aoe s arcane_explosion Fluffy_Pillow 27701.5/69166: 40% mana fireblood, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:31.860 aoe t arcane_barrage Fluffy_Pillow 26983.2/69166: 39% mana arcane_charge(4), arcane_power, rune_of_power, gladiators_badge
4:33.148 aoe s arcane_explosion Fluffy_Pillow 31531.6/69166: 46% mana arcane_power, rune_of_power, gladiators_badge
4:34.435 aoe r arcane_missiles Fluffy_Pillow 30811.9/69166: 45% mana arcane_charge, arcane_power, clearcasting, rune_of_power, gladiators_badge
4:36.393 aoe s arcane_explosion Fluffy_Pillow 33520.4/69166: 48% mana arcane_charge, arcane_power, gladiators_badge
4:37.680 aoe s arcane_explosion Fluffy_Pillow 32800.8/69166: 47% mana arcane_charge(2), arcane_power, gladiators_badge
4:38.967 aoe s arcane_explosion Fluffy_Pillow 32081.1/69166: 46% mana arcane_charge(3)
4:40.254 shared_cds v use_mana_gem dark_iron_dwarf 28861.4/69166: 42% mana arcane_charge(4)
4:40.254 aoe p rune_of_power Fluffy_Pillow 35778.0/69166: 52% mana arcane_charge(4)
4:41.540 aoe t arcane_barrage Fluffy_Pillow 37556.9/69166: 54% mana arcane_charge(4), rune_of_power
4:42.826 aoe s arcane_explosion Fluffy_Pillow 42102.5/69166: 61% mana rune_of_power
4:44.112 aoe s arcane_explosion Fluffy_Pillow 38881.4/69166: 56% mana arcane_charge, rune_of_power
4:45.399 aoe s arcane_explosion Fluffy_Pillow 35661.8/69166: 52% mana arcane_charge(2), rune_of_power
4:46.686 aoe s arcane_explosion Fluffy_Pillow 32442.1/69166: 47% mana arcane_charge(3), rune_of_power
4:47.974 aoe t arcane_barrage Fluffy_Pillow 29223.8/69166: 42% mana arcane_charge(4), rune_of_power
4:49.261 aoe q arcane_orb Fluffy_Pillow 33770.7/69166: 49% mana rune_of_power
4:50.547 aoe t arcane_barrage Fluffy_Pillow 35049.7/69166: 51% mana arcane_charge(4), rune_of_power
4:51.833 aoe s arcane_explosion Fluffy_Pillow 39595.3/69166: 57% mana rune_of_power
4:53.120 aoe s arcane_explosion Fluffy_Pillow 36375.6/69166: 53% mana arcane_charge, rune_of_power
4:54.406 aoe s arcane_explosion Fluffy_Pillow 33154.5/69166: 48% mana arcane_charge(2)
4:55.691 aoe r arcane_missiles Fluffy_Pillow 29932.1/69166: 43% mana arcane_charge(3), clearcasting
4:57.699 aoe s arcane_explosion Fluffy_Pillow 32709.8/69166: 47% mana arcane_charge(3)
4:58.987 aoe t arcane_barrage Fluffy_Pillow 29491.5/69166: 43% mana arcane_charge(4)
5:00.273 aoe s arcane_explosion Fluffy_Pillow 34037.1/69166: 49% mana
5:01.559 aoe s arcane_explosion Fluffy_Pillow 30816.0/69166: 45% mana arcane_charge

Stats

Level Bonus (60) Race Bonus (dark_iron_dwarf) Raid-Buffed Unbuffed Gear Amount
Strength 198 2 200 200 0
Agility 306 -2 304 304 0
Stamina 414 1 2028 1932 1517
Intellect 450 -1 1794 1614 1089 (46)
Spirit 0 0 0 0 0
Health 40560 38640 0
Mana 69166 69166 0
Spell Power 1794 1614 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="dark_iron_dwarf"
source=default
spec=arcane
level=60
race=dark_iron_dwarf
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

draenei : 8917 dps, 4552 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8917.1 8917.1 15.9 / 0.179% 1063.5 / 11.9% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2046.2 1940.8 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
draenei 8917
Arcane Barrage 3764 42.2% 50.1 6.01sec 22600 18272 Direct 150.2 6407 13057 7543 17.1%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.11 150.16 0.00 0.00 1.2369 0.0000 1132545.66 1132545.66 0.00% 18271.58 18271.58
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.91% 124.50 91 158 6407.00 2203 31115 6400.74 5506 7170 797613 797613 0.00%
crit 17.09% 25.66 9 46 13057.27 4407 62230 13016.91 7165 20903 334933 334933 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.11
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 923 1846 1060 14.8%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1059.42 1059.42 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.24% 0.85 0 1 923.18 923 923 786.93 0 923 787 787 0.00%
crit 14.76% 0.15 0 1 1846.35 1846 1846 272.49 0 1846 272 272 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2944 33.0% 129.7 2.29sec 6824 5533 Direct 389.0 1927 3943 2275 17.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.66 388.99 0.00 0.00 1.2333 0.0000 884808.94 884808.94 0.00% 5533.24 5533.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.75% 321.91 235 411 1927.42 1473 3617 1927.77 1829 2083 620367 620367 0.00%
crit 17.25% 67.08 39 108 3943.28 2945 7234 3942.27 3456 4552 264442 264442 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.66
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1002 11.2% 24.2 11.95sec 12439 6548 Periodic 192.9 1327 2706 1561 17.0% 4.4%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.21 0.00 193.06 192.92 1.8996 0.2065 301145.29 301145.29 0.00% 6548.49 6548.49
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.03% 160.18 73 256 1327.15 1079 2651 1326.61 1142 1611 212589 212589 0.00%
crit 16.97% 32.73 9 65 2706.25 2159 5302 2701.63 2208 3691 88556 88556 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.21
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (602) 0.0% (6.7%) 12.7 24.37sec 14204 11455

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.73 0.00 0.00 0.00 1.2400 0.0000 0.00 0.00 0.00% 11454.59 11454.59

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.73
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 602 6.7% 38.1 24.37sec 4741 0 Direct 38.1 4014 8217 4739 17.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.14 38.14 0.00 0.00 0.0000 0.0000 180810.72 180810.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 31.55 19 43 4014.06 2911 7148 4015.40 3237 4694 126657 126657 0.00%
crit 17.26% 6.58 0 15 8217.14 5821 14296 8216.98 0 13891 54153 54153 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 14.0 1.79sec 510 0 Periodic 40.2 (42.1) 113 0 113 0.0% (0.0%) 4.4%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.00 0.00 40.19 40.19 0.0000 0.9861 4540.90 4540.90 0.00% 180.37 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.19 13 65 112.93 0 202 112.99 61 168 4541 4541 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 9.47sec 1343 0 Direct 1.9 1115 2227 1343 20.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.94 1.94 0.00 0.00 0.0000 0.0000 2607.43 2607.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.50% 1.54 0 4 1114.93 1093 1158 1036.23 0 1158 1721 1721 0.00%
crit 20.50% 0.40 0 3 2226.65 2185 2316 790.45 0 2316 886 886 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.1 14.57sec 532 0 Direct 20.1 452 904 532 17.8%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.11 20.11 0.00 0.00 0.0000 0.0000 10707.15 10707.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.24% 16.54 7 32 452.07 444 470 452.10 444 464 7478 7478 0.00%
crit 17.76% 3.57 0 11 904.01 887 941 879.17 0 941 3229 3229 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4152 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 104  / 14 0.2% 90.0 1.31sec 46 35 Direct 90.0 39 79 46 18.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4151.99 4151.99 0.00% 34.76 34.76
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.48% 73.34 60 86 38.75 30 46 38.74 37 40 2841 2841 0.00%
crit 18.52% 16.66 4 30 78.65 60 93 78.65 69 87 1311 1311 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (528) 0.0% (5.9%) 6.2 51.94sec 25590 19893

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19892.74 19892.74

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.22
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 528 5.9% 6.2 51.83sec 25590 0 Direct 18.6 8557 0 8557 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 18.56 0.00 0.00 0.0000 0.0000 158644.59 158644.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.56 15 24 8556.89 1203 44207 8543.86 5690 11774 158645 158645 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:22313.52
  • base_dd_max:22313.52
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
draenei
Arcane Power 2.9 127.08sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.51 0.00 3.03 0.00 4.2166 0.7100 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.51
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.20sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2376 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.07
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.52sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.9 136.8 6.0sec 1.6sec 4.6sec 77.98% 0.00% 2.9 (3.9) 0.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 18.0s
  • trigger_min/max:0.0s / 8.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.5s

Stack Uptimes

  • arcane_charge_1:20.68%
  • arcane_charge_2:17.66%
  • arcane_charge_3:16.89%
  • arcane_charge_4:22.75%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.1sec 127.1sec 14.7sec 14.06% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 141.5s
  • trigger_min/max:120.0s / 141.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.06%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.3 0.0 12.0sec 12.0sec 1.3sec 10.41% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.39%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.7sec 28.7sec 52.02% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.7s
  • trigger_min/max:60.0s / 66.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.32%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 228.8sec 228.8sec 4.2sec 0.72% 0.00% 2.0 (2.0) 0.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:228.8s / 228.8s
  • trigger_min/max:228.8s / 228.8s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 4.3s

Stack Uptimes

  • evocation_1:0.72%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.9 0.0 86.5sec 86.5sec 14.7sec 19.09% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 141.5s
  • trigger_min/max:60.0s / 141.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.09%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 35.01% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 60.5s
  • trigger_min/max:12.2s / 60.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.01%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.94% 0.76% 5.69% 0.9s 0.0s 5.3s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation218.89787.950350.634267.127150.580359.985
Rune of Power6.1080.00032.90138.58817.01482.932
Touch of the Magi4.8250.00044.52931.75914.86385.322
Arcane Power5.0650.00021.53614.7651.33027.015
Arcane Barrage3.5100.00414.231177.649137.548219.314
Arcane Orb4.2300.00018.06754.42031.36392.572

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
draenei
mana_regen Mana 1043.79 405860.91 69.53% 388.83 9604.70 2.31%
Evocation Mana 23.75 26680.03 4.57% 1123.39 0.00 0.00%
Mana Gem Mana 2.74 18980.93 3.25% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.11 132203.69 22.65% 2638.26 6432.70 4.64%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1940.78 2046.19 16044.3 37458.3 47.1 69165.7
Usage Type Count Total Avg RPE APR
draenei
arcane_explosion Mana 129.7 592731.5 4571.6 4571.3 1.5
arcane_orb Mana 12.7 5784.6 454.4 454.4 31.3
touch_of_the_magi Mana 6.2 15487.2 2499.3 2498.2 10.2

Statistics & Data Analysis

Fight Length
draenei Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
draenei Damage Per Second
Count 1118
Mean 8917.12
Minimum 7978.14
Maximum 9797.92
Spread ( max - min ) 1819.78
Range [ ( max - min ) / 2 * 100% ] 10.20%
Standard Deviation 272.0636
5th Percentile 8504.91
95th Percentile 9387.96
( 95th Percentile - 5th Percentile ) 883.06
Mean Distribution
Standard Deviation 8.1367
95.00% Confidence Interval ( 8901.17 - 8933.07 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3576
0.1 Scale Factor Error with Delta=300 632
0.05 Scale Factor Error with Delta=300 2528
0.01 Scale Factor Error with Delta=300 63187
Priority Target DPS
draenei Priority Target Damage Per Second
Count 1118
Mean 4551.63
Minimum 3935.46
Maximum 5257.30
Spread ( max - min ) 1321.84
Range [ ( max - min ) / 2 * 100% ] 14.52%
Standard Deviation 199.4080
5th Percentile 4218.04
95th Percentile 4898.78
( 95th Percentile - 5th Percentile ) 680.74
Mean Distribution
Standard Deviation 5.9638
95.00% Confidence Interval ( 4539.94 - 4563.32 )
Normalized 95.00% Confidence Interval ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 74
0.1% Error 7374
0.1 Scale Factor Error with Delta=300 340
0.05 Scale Factor Error with Delta=300 1358
0.01 Scale Factor Error with Delta=300 33945
DPS(e)
draenei Damage Per Second (Effective)
Count 1118
Mean 8917.12
Minimum 7978.14
Maximum 9797.92
Spread ( max - min ) 1819.78
Range [ ( max - min ) / 2 * 100% ] 10.20%
Damage
draenei Damage
Count 1118
Mean 2676870.11
Minimum 1989118.94
Maximum 3272485.19
Spread ( max - min ) 1283366.26
Range [ ( max - min ) / 2 * 100% ] 23.97%
DTPS
draenei Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
draenei Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
draenei Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
draenei Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
draenei Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
draenei Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
draeneiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
draenei Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.22 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.07 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.73 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.21 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.66 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.11 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.51 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.93 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxtqtsssstsssstsssrsptsssvrstqtsrssstssssrtsssstqtssrsrstssnprtqtsrssstsssrstsssstqtsssstsssstnptsrssstqtssssoxtsssrstssvsstqtsssstsnptsssstqtsssstsrsrsstsssstqtsrsssrtnptsssrstqtsssstssrsstsussstqtssssrtnoxtsssstqtssrssptsssrsrtqtssssvrts

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask draenei 69165.7/69166: 100% mana
Pre precombat U food draenei 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana
0:01.289 aoe o arcane_power Fluffy_Pillow 66675.4/69166: 96% mana bloodlust, crimson_chorus
0:01.289 shared_cds w potion Fluffy_Pillow 66675.4/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:01.289 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66675.4/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.289 aoe t arcane_barrage Fluffy_Pillow 66675.4/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.280 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.270 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.261 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.252 aoe s arcane_explosion Fluffy_Pillow 68036.6/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.242 aoe s arcane_explosion Fluffy_Pillow 66906.1/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.234 aoe s arcane_explosion Fluffy_Pillow 65778.3/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.225 aoe t arcane_barrage Fluffy_Pillow 64649.2/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.217 aoe s arcane_explosion Fluffy_Pillow 68788.0/69166: 99% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.206 aoe s arcane_explosion Fluffy_Pillow 67656.1/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.196 aoe s arcane_explosion Fluffy_Pillow 66525.6/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.185 aoe s arcane_explosion Fluffy_Pillow 65393.7/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.174 aoe t arcane_barrage Fluffy_Pillow 64261.8/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.166 aoe s arcane_explosion Fluffy_Pillow 68400.7/69166: 99% mana bloodlust, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.155 aoe s arcane_explosion Fluffy_Pillow 67268.8/69166: 97% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.144 aoe s arcane_explosion Fluffy_Pillow 66136.9/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.134 aoe r arcane_missiles Fluffy_Pillow 65006.4/69166: 94% mana bloodlust, arcane_charge(3), clearcasting, crimson_chorus(2), potion_of_deathly_fixation
0:18.687 aoe s arcane_explosion Fluffy_Pillow 67154.7/69166: 97% mana bloodlust, arcane_charge(3), crimson_chorus(2), potion_of_deathly_fixation
0:19.679 aoe p rune_of_power Fluffy_Pillow 63526.9/69166: 92% mana bloodlust, arcane_charge(4), crimson_chorus(2), potion_of_deathly_fixation
0:20.669 aoe t arcane_barrage Fluffy_Pillow 64896.4/69166: 94% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.658 aoe s arcane_explosion Fluffy_Pillow 69031.1/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.647 aoe s arcane_explosion Fluffy_Pillow 65399.2/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.638 aoe s arcane_explosion Fluffy_Pillow 61770.1/69166: 89% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.629 shared_cds v use_mana_gem draenei 58140.9/69166: 84% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.629 aoe r arcane_missiles Fluffy_Pillow 65057.5/69166: 94% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.167 aoe s arcane_explosion Fluffy_Pillow 67185.1/69166: 97% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.158 aoe t arcane_barrage Fluffy_Pillow 63555.9/69166: 92% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3)
0:28.149 aoe q arcane_orb Fluffy_Pillow 67693.4/69166: 98% mana bloodlust, rune_of_power, crimson_chorus(3)
0:29.138 aoe t arcane_barrage Fluffy_Pillow 68561.5/69166: 99% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3)
0:30.129 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power
0:31.119 aoe r arcane_missiles Fluffy_Pillow 65535.2/69166: 95% mana bloodlust, arcane_charge, clearcasting, rune_of_power
0:32.736 aoe s arcane_explosion Fluffy_Pillow 67772.0/69166: 98% mana bloodlust, arcane_charge
0:33.728 aoe s arcane_explosion Fluffy_Pillow 64144.3/69166: 93% mana bloodlust, arcane_charge(2)
0:34.719 aoe s arcane_explosion Fluffy_Pillow 60515.1/69166: 87% mana bloodlust, arcane_charge(3)
0:35.709 aoe t arcane_barrage Fluffy_Pillow 56884.6/69166: 82% mana bloodlust, arcane_charge(4)
0:36.699 aoe s arcane_explosion Fluffy_Pillow 61020.7/69166: 88% mana bloodlust
0:37.690 aoe s arcane_explosion Fluffy_Pillow 57391.6/69166: 83% mana bloodlust, arcane_charge
0:38.680 aoe s arcane_explosion Fluffy_Pillow 53761.1/69166: 78% mana bloodlust, arcane_charge(2)
0:39.671 aoe s arcane_explosion Fluffy_Pillow 50131.9/69166: 72% mana bloodlust, arcane_charge(3)
0:40.661 aoe r arcane_missiles Fluffy_Pillow 46501.4/69166: 67% mana bloodlust, arcane_charge(4), clearcasting
0:42.229 aoe t arcane_barrage Fluffy_Pillow 48670.4/69166: 70% mana arcane_charge(4)
0:43.515 aoe s arcane_explosion Fluffy_Pillow 53216.0/69166: 77% mana
0:44.801 aoe s arcane_explosion Fluffy_Pillow 49995.0/69166: 72% mana arcane_charge
0:46.089 aoe s arcane_explosion Fluffy_Pillow 46776.7/69166: 68% mana arcane_charge(2)
0:47.376 aoe s arcane_explosion Fluffy_Pillow 43557.0/69166: 63% mana arcane_charge(3)
0:48.663 aoe t arcane_barrage Fluffy_Pillow 40337.3/69166: 58% mana arcane_charge(4)
0:49.950 aoe q arcane_orb Fluffy_Pillow 44884.3/69166: 65% mana
0:51.237 aoe t arcane_barrage Fluffy_Pillow 46164.6/69166: 67% mana arcane_charge(4)
0:52.522 aoe s arcane_explosion Fluffy_Pillow 50708.8/69166: 73% mana
0:53.809 aoe s arcane_explosion Fluffy_Pillow 47489.1/69166: 69% mana arcane_charge
0:55.096 aoe r arcane_missiles Fluffy_Pillow 44269.4/69166: 64% mana arcane_charge(2), clearcasting
0:57.009 aoe s arcane_explosion Fluffy_Pillow 46915.7/69166: 68% mana arcane_charge(2)
0:58.296 aoe r arcane_missiles Fluffy_Pillow 43696.0/69166: 63% mana arcane_charge(3), clearcasting
1:00.205 aoe s arcane_explosion Fluffy_Pillow 46336.8/69166: 67% mana arcane_charge(3)
1:01.492 aoe t arcane_barrage Fluffy_Pillow 43117.1/69166: 62% mana arcane_charge(4), crimson_chorus
1:02.779 aoe s arcane_explosion Fluffy_Pillow 47664.1/69166: 69% mana crimson_chorus
1:04.066 aoe s arcane_explosion Fluffy_Pillow 44444.4/69166: 64% mana arcane_charge, crimson_chorus
1:05.354 aoe n touch_of_the_magi Fluffy_Pillow 41226.1/69166: 60% mana arcane_charge(2), clearcasting, crimson_chorus
1:06.640 aoe p rune_of_power Fluffy_Pillow 40505.0/69166: 59% mana arcane_charge(4), clearcasting, crimson_chorus
1:07.927 aoe r arcane_missiles Fluffy_Pillow 42285.4/69166: 61% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
1:09.866 aoe t arcane_barrage Fluffy_Pillow 44967.6/69166: 65% mana arcane_charge(4), rune_of_power, crimson_chorus
1:11.153 aoe q arcane_orb Fluffy_Pillow 49514.6/69166: 72% mana rune_of_power, crimson_chorus(2)
1:12.439 aoe t arcane_barrage Fluffy_Pillow 50793.5/69166: 73% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:13.726 aoe s arcane_explosion Fluffy_Pillow 55340.5/69166: 80% mana rune_of_power, crimson_chorus(2)
1:15.015 aoe r arcane_missiles Fluffy_Pillow 52123.6/69166: 75% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(2)
1:17.009 aoe s arcane_explosion Fluffy_Pillow 54881.9/69166: 79% mana arcane_charge, rune_of_power, crimson_chorus(2)
1:18.296 aoe s arcane_explosion Fluffy_Pillow 51662.2/69166: 75% mana arcane_charge(2), rune_of_power, crimson_chorus(2)
1:19.580 aoe s arcane_explosion Fluffy_Pillow 48438.4/69166: 70% mana arcane_charge(3), rune_of_power, crimson_chorus(2)
1:20.866 aoe t arcane_barrage Fluffy_Pillow 45217.3/69166: 65% mana arcane_charge(4), crimson_chorus(3)
1:22.152 aoe s arcane_explosion Fluffy_Pillow 49762.9/69166: 72% mana crimson_chorus(3)
1:23.439 aoe s arcane_explosion Fluffy_Pillow 46543.2/69166: 67% mana arcane_charge, crimson_chorus(3)
1:24.726 aoe s arcane_explosion Fluffy_Pillow 43323.6/69166: 63% mana arcane_charge(2), crimson_chorus(3)
1:26.013 aoe r arcane_missiles Fluffy_Pillow 40103.9/69166: 58% mana arcane_charge(3), clearcasting, crimson_chorus(3)
1:27.996 aoe s arcane_explosion Fluffy_Pillow 42847.0/69166: 62% mana arcane_charge(3), crimson_chorus(3)
1:29.282 aoe t arcane_barrage Fluffy_Pillow 39625.9/69166: 57% mana arcane_charge(4), crimson_chorus(3)
1:30.567 aoe s arcane_explosion Fluffy_Pillow 44170.1/69166: 64% mana
1:31.856 aoe s arcane_explosion Fluffy_Pillow 40953.2/69166: 59% mana arcane_charge
1:33.142 aoe s arcane_explosion Fluffy_Pillow 37732.2/69166: 55% mana arcane_charge(2)
1:34.429 aoe s arcane_explosion Fluffy_Pillow 34512.5/69166: 50% mana arcane_charge(3)
1:35.716 aoe t arcane_barrage Fluffy_Pillow 31292.8/69166: 45% mana arcane_charge(4)
1:37.002 aoe q arcane_orb Fluffy_Pillow 35838.4/69166: 52% mana
1:38.288 aoe t arcane_barrage Fluffy_Pillow 37117.3/69166: 54% mana arcane_charge(4)
1:39.574 aoe s arcane_explosion Fluffy_Pillow 41662.9/69166: 60% mana
1:40.862 aoe s arcane_explosion Fluffy_Pillow 38444.6/69166: 56% mana arcane_charge
1:42.150 aoe s arcane_explosion Fluffy_Pillow 35226.3/69166: 51% mana arcane_charge(2)
1:43.436 aoe s arcane_explosion Fluffy_Pillow 32005.2/69166: 46% mana arcane_charge(3)
1:44.723 aoe t arcane_barrage Fluffy_Pillow 28785.6/69166: 42% mana arcane_charge(4)
1:46.008 aoe s arcane_explosion Fluffy_Pillow 33329.8/69166: 48% mana
1:47.294 aoe s arcane_explosion Fluffy_Pillow 30108.7/69166: 44% mana arcane_charge
1:48.580 aoe s arcane_explosion Fluffy_Pillow 26887.6/69166: 39% mana arcane_charge(2)
1:49.865 aoe s arcane_explosion Fluffy_Pillow 23665.2/69166: 34% mana arcane_charge(3)
1:51.152 aoe t arcane_barrage Fluffy_Pillow 20445.5/69166: 30% mana arcane_charge(4)
1:52.439 aoe n touch_of_the_magi Fluffy_Pillow 24992.5/69166: 36% mana
1:53.726 aoe p rune_of_power Fluffy_Pillow 24272.8/69166: 35% mana arcane_charge(4)
1:55.012 aoe t arcane_barrage Fluffy_Pillow 26051.8/69166: 38% mana arcane_charge(4), rune_of_power
1:56.298 aoe s arcane_explosion Fluffy_Pillow 30597.3/69166: 44% mana rune_of_power
1:57.584 aoe r arcane_missiles Fluffy_Pillow 27376.3/69166: 40% mana arcane_charge, clearcasting, rune_of_power
1:59.589 aoe s arcane_explosion Fluffy_Pillow 30149.8/69166: 44% mana arcane_charge, rune_of_power
2:00.875 aoe s arcane_explosion Fluffy_Pillow 26928.8/69166: 39% mana arcane_charge(2), rune_of_power
2:02.162 aoe s arcane_explosion Fluffy_Pillow 23709.1/69166: 34% mana arcane_charge(3), rune_of_power, crimson_chorus
2:03.448 aoe t arcane_barrage Fluffy_Pillow 20488.0/69166: 30% mana arcane_charge(4), rune_of_power, crimson_chorus
2:04.735 aoe q arcane_orb Fluffy_Pillow 25035.0/69166: 36% mana rune_of_power, crimson_chorus
2:06.021 aoe t arcane_barrage Fluffy_Pillow 26313.9/69166: 38% mana arcane_charge(4), rune_of_power, crimson_chorus
2:07.306 aoe s arcane_explosion Fluffy_Pillow 30858.1/69166: 45% mana crimson_chorus
2:08.591 aoe s arcane_explosion Fluffy_Pillow 27635.7/69166: 40% mana arcane_charge, crimson_chorus
2:09.877 aoe s arcane_explosion Fluffy_Pillow 24414.6/69166: 35% mana arcane_charge(2), crimson_chorus
2:11.164 aoe s arcane_explosion Fluffy_Pillow 21194.9/69166: 31% mana arcane_charge(3), crimson_chorus(2)
2:12.450 aoe o arcane_power Fluffy_Pillow 17973.9/69166: 26% mana arcane_charge(4), crimson_chorus(2)
2:12.450 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 17973.9/69166: 26% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
2:12.450 aoe t arcane_barrage Fluffy_Pillow 17973.9/69166: 26% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.737 aoe s arcane_explosion Fluffy_Pillow 22520.8/69166: 33% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.023 aoe s arcane_explosion Fluffy_Pillow 21799.8/69166: 32% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.309 aoe s arcane_explosion Fluffy_Pillow 21078.7/69166: 30% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.595 aoe r arcane_missiles Fluffy_Pillow 20357.7/69166: 29% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.678 aoe s arcane_explosion Fluffy_Pillow 23239.1/69166: 34% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.965 aoe t arcane_barrage Fluffy_Pillow 22519.4/69166: 33% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:22.252 aoe s arcane_explosion Fluffy_Pillow 27066.4/69166: 39% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:23.538 aoe s arcane_explosion Fluffy_Pillow 26345.3/69166: 38% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:24.825 shared_cds v use_mana_gem draenei 25625.6/69166: 37% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
2:24.825 aoe s arcane_explosion Fluffy_Pillow 32542.2/69166: 47% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
2:26.111 aoe s arcane_explosion Fluffy_Pillow 31821.2/69166: 46% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
2:27.397 aoe t arcane_barrage Fluffy_Pillow 31100.1/69166: 45% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
2:28.685 aoe q arcane_orb Fluffy_Pillow 35648.4/69166: 52% mana crimson_chorus(3)
2:29.973 aoe t arcane_barrage Fluffy_Pillow 36930.1/69166: 53% mana arcane_charge(4), crimson_chorus(3)
2:31.259 aoe s arcane_explosion Fluffy_Pillow 41475.7/69166: 60% mana
2:32.546 aoe s arcane_explosion Fluffy_Pillow 38256.0/69166: 55% mana arcane_charge
2:33.832 aoe s arcane_explosion Fluffy_Pillow 35035.0/69166: 51% mana arcane_charge(2)
2:35.118 aoe s arcane_explosion Fluffy_Pillow 31813.9/69166: 46% mana arcane_charge(3)
2:36.407 aoe t arcane_barrage Fluffy_Pillow 28597.0/69166: 41% mana arcane_charge(4)
2:37.694 aoe s arcane_explosion Fluffy_Pillow 33144.0/69166: 48% mana
2:38.980 aoe n touch_of_the_magi Fluffy_Pillow 29922.9/69166: 43% mana arcane_charge
2:40.265 aoe p rune_of_power Fluffy_Pillow 29200.5/69166: 42% mana arcane_charge(4)
2:41.553 aoe t arcane_barrage Fluffy_Pillow 30982.2/69166: 45% mana arcane_charge(4), rune_of_power
2:42.839 aoe s arcane_explosion Fluffy_Pillow 35527.8/69166: 51% mana rune_of_power
2:44.125 aoe s arcane_explosion Fluffy_Pillow 32306.7/69166: 47% mana arcane_charge, rune_of_power
2:45.410 aoe s arcane_explosion Fluffy_Pillow 29084.3/69166: 42% mana arcane_charge(2), rune_of_power
2:46.697 aoe s arcane_explosion Fluffy_Pillow 25864.6/69166: 37% mana arcane_charge(3), rune_of_power
2:47.982 aoe t arcane_barrage Fluffy_Pillow 22642.1/69166: 33% mana arcane_charge(4), rune_of_power
2:49.269 aoe q arcane_orb Fluffy_Pillow 27189.1/69166: 39% mana rune_of_power
2:50.558 aoe t arcane_barrage Fluffy_Pillow 28472.2/69166: 41% mana arcane_charge(4), rune_of_power
2:51.846 aoe s arcane_explosion Fluffy_Pillow 33020.5/69166: 48% mana rune_of_power
2:53.134 aoe s arcane_explosion Fluffy_Pillow 29802.2/69166: 43% mana arcane_charge, rune_of_power
2:54.420 aoe s arcane_explosion Fluffy_Pillow 26581.2/69166: 38% mana arcane_charge(2)
2:55.707 aoe s arcane_explosion Fluffy_Pillow 23361.5/69166: 34% mana arcane_charge(3)
2:56.994 aoe t arcane_barrage Fluffy_Pillow 20141.8/69166: 29% mana arcane_charge(4)
2:58.280 aoe s arcane_explosion Fluffy_Pillow 24687.4/69166: 36% mana
2:59.566 aoe r arcane_missiles Fluffy_Pillow 21466.3/69166: 31% mana arcane_charge, clearcasting
3:01.507 aoe s arcane_explosion Fluffy_Pillow 24151.3/69166: 35% mana arcane_charge, crimson_chorus
3:02.794 aoe r arcane_missiles Fluffy_Pillow 20931.7/69166: 30% mana arcane_charge(2), clearcasting, crimson_chorus
3:04.804 aoe s arcane_explosion Fluffy_Pillow 23712.1/69166: 34% mana arcane_charge(2), crimson_chorus
3:06.091 aoe s arcane_explosion Fluffy_Pillow 20492.5/69166: 30% mana arcane_charge(3), crimson_chorus
3:07.377 aoe t arcane_barrage Fluffy_Pillow 17271.4/69166: 25% mana arcane_charge(4), crimson_chorus
3:08.663 aoe s arcane_explosion Fluffy_Pillow 21817.0/69166: 32% mana crimson_chorus
3:09.950 aoe s arcane_explosion Fluffy_Pillow 18597.3/69166: 27% mana arcane_charge, crimson_chorus
3:11.234 aoe s arcane_explosion Fluffy_Pillow 15373.5/69166: 22% mana arcane_charge(2), crimson_chorus(2)
3:12.521 aoe s arcane_explosion Fluffy_Pillow 12153.8/69166: 18% mana arcane_charge(3), crimson_chorus(2)
3:13.808 aoe t arcane_barrage Fluffy_Pillow 8934.1/69166: 13% mana arcane_charge(4), crimson_chorus(2)
3:15.094 aoe q arcane_orb Fluffy_Pillow 13479.7/69166: 19% mana crimson_chorus(2)
3:16.379 aoe t arcane_barrage Fluffy_Pillow 14757.3/69166: 21% mana arcane_charge(4), crimson_chorus(2)
3:17.667 aoe s arcane_explosion Fluffy_Pillow 19305.6/69166: 28% mana crimson_chorus(2)
3:18.953 aoe r arcane_missiles Fluffy_Pillow 16084.5/69166: 23% mana arcane_charge, clearcasting, crimson_chorus(2)
3:20.935 aoe s arcane_explosion Fluffy_Pillow 18826.3/69166: 27% mana arcane_charge, crimson_chorus(2)
3:22.221 aoe s arcane_explosion Fluffy_Pillow 15605.2/69166: 23% mana arcane_charge(2), crimson_chorus(3)
3:23.507 aoe s arcane_explosion Fluffy_Pillow 12384.1/69166: 18% mana arcane_charge(3), crimson_chorus(3)
3:24.794 aoe r arcane_missiles Fluffy_Pillow 9164.5/69166: 13% mana arcane_charge(4), clearcasting, crimson_chorus(3)
3:26.681 aoe t arcane_barrage Fluffy_Pillow 11774.8/69166: 17% mana arcane_charge(4), crimson_chorus(3)
3:27.967 aoe n touch_of_the_magi Fluffy_Pillow 16320.4/69166: 24% mana crimson_chorus(3)
3:29.253 aoe p rune_of_power Fluffy_Pillow 15599.3/69166: 23% mana arcane_charge(4), crimson_chorus(3)
3:30.539 aoe t arcane_barrage Fluffy_Pillow 17378.2/69166: 25% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:31.824 aoe s arcane_explosion Fluffy_Pillow 21922.4/69166: 32% mana rune_of_power
3:33.110 aoe s arcane_explosion Fluffy_Pillow 18701.4/69166: 27% mana arcane_charge, rune_of_power
3:34.396 aoe s arcane_explosion Fluffy_Pillow 15480.3/69166: 22% mana arcane_charge(2), rune_of_power
3:35.681 aoe r arcane_missiles Fluffy_Pillow 12257.9/69166: 18% mana arcane_charge(3), clearcasting, rune_of_power
3:37.555 aoe s arcane_explosion Fluffy_Pillow 14850.2/69166: 21% mana arcane_charge(3), rune_of_power
3:38.842 aoe t arcane_barrage Fluffy_Pillow 11630.5/69166: 17% mana arcane_charge(4), rune_of_power
3:40.129 aoe q arcane_orb Fluffy_Pillow 16177.5/69166: 23% mana rune_of_power
3:41.416 aoe t arcane_barrage Fluffy_Pillow 17457.8/69166: 25% mana arcane_charge(4), rune_of_power
3:42.705 aoe s arcane_explosion Fluffy_Pillow 22007.5/69166: 32% mana
3:43.991 aoe s arcane_explosion Fluffy_Pillow 18786.5/69166: 27% mana arcane_charge
3:45.277 aoe s arcane_explosion Fluffy_Pillow 15565.4/69166: 23% mana arcane_charge(2)
3:46.565 aoe s arcane_explosion Fluffy_Pillow 12347.1/69166: 18% mana arcane_charge(3)
3:47.851 aoe t arcane_barrage Fluffy_Pillow 9126.1/69166: 13% mana arcane_charge(4)
3:49.139 aoe s arcane_explosion Fluffy_Pillow 13674.4/69166: 20% mana
3:50.424 aoe s arcane_explosion Fluffy_Pillow 10452.0/69166: 15% mana arcane_charge
3:51.713 aoe r arcane_missiles Fluffy_Pillow 7235.1/69166: 10% mana arcane_charge(2), clearcasting
3:53.614 aoe s arcane_explosion Fluffy_Pillow 9864.7/69166: 14% mana arcane_charge(2)
3:54.901 aoe s arcane_explosion Fluffy_Pillow 6645.1/69166: 10% mana arcane_charge(3)
3:56.186 aoe t arcane_barrage Fluffy_Pillow 3422.6/69166: 5% mana arcane_charge(4)
3:57.474 aoe s arcane_explosion Fluffy_Pillow 7971.0/69166: 12% mana
3:58.760 aoe u evocation draenei 4749.9/69166: 7% mana arcane_charge
4:03.034 aoe s arcane_explosion Fluffy_Pillow 63498.1/69166: 92% mana arcane_charge
4:04.319 aoe s arcane_explosion Fluffy_Pillow 60275.6/69166: 87% mana arcane_charge(2), crimson_chorus
4:05.606 aoe s arcane_explosion Fluffy_Pillow 57056.0/69166: 82% mana arcane_charge(3), crimson_chorus
4:06.894 aoe t arcane_barrage Fluffy_Pillow 53837.7/69166: 78% mana arcane_charge(4), crimson_chorus
4:08.179 aoe q arcane_orb Fluffy_Pillow 58381.9/69166: 84% mana crimson_chorus
4:09.464 aoe t arcane_barrage Fluffy_Pillow 59659.4/69166: 86% mana arcane_charge(4), crimson_chorus
4:10.751 aoe s arcane_explosion Fluffy_Pillow 64206.4/69166: 93% mana crimson_chorus
4:12.037 aoe s arcane_explosion Fluffy_Pillow 60985.3/69166: 88% mana arcane_charge, crimson_chorus
4:13.324 aoe s arcane_explosion Fluffy_Pillow 57765.6/69166: 84% mana arcane_charge(2), crimson_chorus(2)
4:14.610 aoe s arcane_explosion Fluffy_Pillow 54544.6/69166: 79% mana arcane_charge(3), crimson_chorus(2)
4:15.899 aoe r arcane_missiles Fluffy_Pillow 51327.7/69166: 74% mana arcane_charge(4), clearcasting, crimson_chorus(2)
4:17.793 aoe t arcane_barrage Fluffy_Pillow 53947.7/69166: 78% mana arcane_charge(4), crimson_chorus(2)
4:19.080 aoe n touch_of_the_magi Fluffy_Pillow 58494.6/69166: 85% mana crimson_chorus(2)
4:20.366 aoe o arcane_power Fluffy_Pillow 57773.6/69166: 84% mana arcane_charge(4), crimson_chorus(2)
4:20.366 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 57773.6/69166: 84% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:20.366 aoe t arcane_barrage Fluffy_Pillow 57773.6/69166: 84% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.653 aoe s arcane_explosion Fluffy_Pillow 62320.5/69166: 90% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.940 aoe s arcane_explosion Fluffy_Pillow 61600.8/69166: 89% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:24.226 aoe s arcane_explosion Fluffy_Pillow 60879.8/69166: 88% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.512 aoe s arcane_explosion Fluffy_Pillow 60158.7/69166: 87% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.799 aoe t arcane_barrage Fluffy_Pillow 59439.1/69166: 86% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:28.087 aoe q arcane_orb Fluffy_Pillow 63987.4/69166: 93% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:29.465 aoe t arcane_barrage Fluffy_Pillow 65643.6/69166: 95% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:30.751 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:32.039 aoe s arcane_explosion Fluffy_Pillow 68447.4/69166: 99% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:33.326 aoe r arcane_missiles Fluffy_Pillow 67727.7/69166: 98% mana arcane_charge(2), arcane_power, clearcasting, gladiators_badge
4:35.350 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana arcane_charge(2), arcane_power, gladiators_badge
4:36.637 aoe s arcane_explosion Fluffy_Pillow 68446.0/69166: 99% mana arcane_charge(3)
4:37.923 aoe p rune_of_power Fluffy_Pillow 65225.0/69166: 94% mana arcane_charge(4)
4:39.211 aoe t arcane_barrage Fluffy_Pillow 67006.7/69166: 97% mana arcane_charge(4), rune_of_power
4:40.500 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana rune_of_power
4:41.787 aoe s arcane_explosion Fluffy_Pillow 65946.0/69166: 95% mana arcane_charge, rune_of_power
4:43.075 aoe s arcane_explosion Fluffy_Pillow 62727.7/69166: 91% mana arcane_charge(2), rune_of_power
4:44.363 aoe r arcane_missiles Fluffy_Pillow 59509.5/69166: 86% mana arcane_charge(3), clearcasting, rune_of_power
4:46.288 aoe s arcane_explosion Fluffy_Pillow 62172.3/69166: 90% mana arcane_charge(3), rune_of_power
4:47.573 aoe r arcane_missiles Fluffy_Pillow 58949.9/69166: 85% mana arcane_charge(4), clearcasting, rune_of_power
4:49.532 aoe t arcane_barrage Fluffy_Pillow 61659.8/69166: 89% mana arcane_charge(4), rune_of_power
4:50.816 aoe q arcane_orb Fluffy_Pillow 66202.6/69166: 96% mana rune_of_power
4:52.103 aoe t arcane_barrage Fluffy_Pillow 67482.9/69166: 98% mana arcane_charge(4)
4:53.391 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana
4:54.678 aoe s arcane_explosion Fluffy_Pillow 65946.0/69166: 95% mana arcane_charge
4:55.965 aoe s arcane_explosion Fluffy_Pillow 62726.4/69166: 91% mana arcane_charge(2)
4:57.250 aoe s arcane_explosion Fluffy_Pillow 59503.9/69166: 86% mana arcane_charge(3)
4:58.535 shared_cds v use_mana_gem draenei 56281.5/69166: 81% mana arcane_charge(4), clearcasting
4:58.535 aoe r arcane_missiles Fluffy_Pillow 63198.1/69166: 91% mana arcane_charge(4), clearcasting
5:00.433 aoe t arcane_barrage Fluffy_Pillow 65823.6/69166: 95% mana arcane_charge(4)
5:01.719 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana

Stats

Level Bonus (60) Race Bonus (draenei) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 222 222 0
Agility 306 -3 326 326 0
Stamina 414 2 2029 1933 1517
Intellect 450 0 1821 1640 1089 (46)
Spirit 0 0 0 0 0
Health 40580 38660 0
Mana 69166 69166 0
Spell Power 1821 1640 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="draenei"
source=default
spec=arcane
level=60
race=draenei
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

dwarf : 8847 dps, 4527 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8847.3 8847.3 16.1 / 0.181% 1074.2 / 12.1% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2042.0 1934.7 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
dwarf 8847
Arcane Barrage 3727 42.2% 50.0 6.03sec 22427 18132 Direct 149.8 6305 13173 7489 17.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.01 149.83 0.00 0.00 1.2369 0.0000 1121621.04 1121621.04 0.00% 18131.60 18131.60
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.77% 124.01 88 162 6304.75 2171 30712 6295.28 5455 7160 781635 781635 0.00%
crit 17.23% 25.82 11 44 13173.15 4428 62653 13138.48 8001 19933 339986 339986 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.02
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 909 1855 1051 15.1%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1052.47 1052.47 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.88% 0.85 0 1 909.49 909 909 772.01 0 909 772 772 0.00%
crit 15.12% 0.15 0 1 1855.36 1855 1855 280.46 0 1855 280 280 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2913 32.9% 129.4 2.29sec 6765 5486 Direct 388.2 1898 3974 2255 17.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.41 388.24 0.00 0.00 1.2332 0.0000 875517.54 875517.54 0.00% 5485.97 5485.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.79% 321.44 239 429 1898.25 1451 3570 1898.56 1761 2020 610120 610120 0.00%
crit 17.21% 66.80 34 101 3974.11 2960 7283 3973.51 3292 4654 265398 265398 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.43
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1010 11.4% 24.5 11.79sec 12380 6515 Periodic 195.5 1313 2727 1553 17.0% 4.5%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.52 0.00 195.59 195.47 1.9002 0.2066 303554.08 303554.08 0.00% 6515.15 6515.15
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.04% 162.32 76 264 1312.89 1063 2617 1311.93 1104 1678 213105 213105 0.00%
crit 16.96% 33.15 7 61 2727.09 2169 5338 2723.89 2215 3680 90449 90449 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.50
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (594) 0.0% (6.7%) 12.7 24.45sec 14024 11310

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.73 0.00 0.00 0.00 1.2400 0.0000 0.00 0.00 0.00% 11309.93 11309.93

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.73
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 594 6.7% 38.1 24.45sec 4682 0 Direct 38.1 3949 8243 4682 17.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.14 38.14 0.00 0.00 0.0000 0.0000 178583.73 178583.73 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.91% 31.62 19 44 3949.01 2867 7055 3947.72 3198 4578 124838 124838 0.00%
crit 17.09% 6.52 1 17 8242.66 5850 14393 8253.44 5850 13578 53746 53746 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 13.8 1.79sec 519 0 Periodic 40.6 (42.5) 112 0 112 0.0% (0.0%) 4.4%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.78 0.00 40.58 40.58 0.0000 0.9872 4540.87 4540.87 0.00% 178.61 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.58 14 65 111.92 0 202 111.88 71 166 4541 4541 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 9.41sec 1363 0 Direct 1.9 1115 2275 1365 21.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.92 1.92 0.00 0.00 0.0000 0.0000 2614.19 2614.19 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.64% 1.51 0 4 1115.37 1093 1158 1025.93 0 1158 1682 1682 0.00%
crit 21.36% 0.41 0 3 2275.47 2229 2363 810.08 0 2363 932 932 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.5 14.31sec 533 0 Direct 20.5 452 922 532 17.2%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.51 20.51 0.00 0.00 0.0000 0.0000 10925.02 10925.02 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.83% 16.99 6 31 451.90 444 470 451.92 444 464 7679 7679 0.00%
crit 17.17% 3.52 0 11 921.87 905 960 899.74 0 960 3246 3246 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4109 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 103  / 14 0.2% 90.0 1.31sec 46 34 Direct 90.0 38 79 46 18.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4108.63 4108.63 0.00% 34.40 34.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.82% 73.64 62 85 38.21 30 46 38.21 37 40 2814 2814 0.00%
crit 18.18% 16.36 5 28 79.12 60 93 79.14 68 89 1295 1295 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (525) 0.0% (5.9%) 6.2 52.07sec 25440 19774

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19774.18 19774.18

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.22
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 525 5.9% 6.2 51.97sec 25440 0 Direct 18.6 8507 0 8507 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.58 0.00 0.00 0.0000 0.0000 157916.62 157916.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.58 15 21 8507.14 712 49126 8486.56 5144 12437 157917 157917 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21270.09
  • base_dd_max:21270.09
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
dwarf
Arcane Power 2.9 127.19sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.47 0.00 2.80 0.00 4.2387 0.7107 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.47
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.30sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 1.2377 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.09
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.06sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:dwarf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.8 136.7 6.0sec 1.6sec 4.6sec 78.05% 0.00% 3.0 (4.0) 0.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 16.6s
  • trigger_min/max:0.0s / 8.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.3s

Stack Uptimes

  • arcane_charge_1:20.64%
  • arcane_charge_2:17.66%
  • arcane_charge_3:16.89%
  • arcane_charge_4:22.86%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.2sec 127.2sec 14.7sec 14.04% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 138.3s
  • trigger_min/max:120.0s / 138.3s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 15.0s

Stack Uptimes

  • arcane_power_1:14.04%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.7 0.0 11.8sec 11.8sec 1.3sec 10.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.55%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.06% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.5s
  • trigger_min/max:60.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.78%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 0.0sec 0.0sec 4.2sec 0.66% 0.00% 1.9 (1.9) 0.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 4.3s

Stack Uptimes

  • evocation_1:0.66%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.9 0.0 86.6sec 86.6sec 14.6sec 19.09% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 137.9s
  • trigger_min/max:60.0s / 137.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.09%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 35.02% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 59.0s
  • trigger_min/max:12.2s / 59.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.02%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.89% 0.77% 5.67% 0.9s 0.0s 4.0s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation217.83784.419353.306269.510151.903359.865
Rune of Power6.1570.00031.29938.83416.59682.465
Touch of the Magi4.8720.00045.29131.77715.10676.451
Arcane Power5.1670.02418.29115.0112.20928.191
Arcane Barrage3.5210.00314.072177.907137.455220.793
Arcane Orb4.2120.00017.53954.16531.97487.940

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
dwarf
mana_regen Mana 1049.80 406180.18 69.80% 386.91 9296.74 2.24%
Evocation Mana 21.96 24666.20 4.24% 1123.13 0.00 0.00%
Mana Gem Mana 2.75 19048.02 3.27% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.02 132042.69 22.69% 2640.02 6332.65 4.58%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1934.69 2041.99 15628.1 36893.3 71.0 69165.7
Usage Type Count Total Avg RPE APR
dwarf
arcane_explosion Mana 129.4 591560.8 4570.4 4571.1 1.5
arcane_orb Mana 12.7 5796.3 455.2 455.2 30.8
touch_of_the_magi Mana 6.2 15508.2 2499.5 2498.3 10.2

Statistics & Data Analysis

Fight Length
dwarf Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
dwarf Damage Per Second
Count 1118
Mean 8847.30
Minimum 7909.96
Maximum 9842.28
Spread ( max - min ) 1932.32
Range [ ( max - min ) / 2 * 100% ] 10.92%
Standard Deviation 273.8443
5th Percentile 8419.28
95th Percentile 9318.41
( 95th Percentile - 5th Percentile ) 899.13
Mean Distribution
Standard Deviation 8.1900
95.00% Confidence Interval ( 8831.24 - 8863.35 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3681
0.1 Scale Factor Error with Delta=300 641
0.05 Scale Factor Error with Delta=300 2561
0.01 Scale Factor Error with Delta=300 64017
Priority Target DPS
dwarf Priority Target Damage Per Second
Count 1118
Mean 4527.35
Minimum 3741.83
Maximum 5334.72
Spread ( max - min ) 1592.89
Range [ ( max - min ) / 2 * 100% ] 17.59%
Standard Deviation 212.0277
5th Percentile 4183.11
95th Percentile 4885.51
( 95th Percentile - 5th Percentile ) 702.40
Mean Distribution
Standard Deviation 6.3412
95.00% Confidence Interval ( 4514.92 - 4539.78 )
Normalized 95.00% Confidence Interval ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 85
0.1% Error 8426
0.1 Scale Factor Error with Delta=300 384
0.05 Scale Factor Error with Delta=300 1536
0.01 Scale Factor Error with Delta=300 38377
DPS(e)
dwarf Damage Per Second (Effective)
Count 1118
Mean 8847.30
Minimum 7909.96
Maximum 9842.28
Spread ( max - min ) 1932.32
Range [ ( max - min ) / 2 * 100% ] 10.92%
Damage
dwarf Damage
Count 1118
Mean 2656325.56
Minimum 1998719.70
Maximum 3255884.07
Spread ( max - min ) 1257164.38
Range [ ( max - min ) / 2 * 100% ] 23.66%
DTPS
dwarf Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
dwarf Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
dwarf Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
dwarf Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
dwarf Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
dwarf Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
dwarfTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
dwarf Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.22 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.09 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.73 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.50 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.43 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.02 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.47 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.95 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxrtqtsssstssssptssrssvrtqtsssrstssrsstsssstqtssrsstsrnxptsrsrsstqtsssrstsssstsssstqtsssrstnptsrssrstqoxtsssstsssstsssvstqtsssstsnptsrssrsrtqtsssstssssrtsssstqtsssstnprtsssrsrtqtsssstsrsrsrstqtsssstnoxtsssstssvssprtqtsssrstssssrtsssstqtsss

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask dwarf 69165.7/69166: 100% mana
Pre precombat U food dwarf 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana clearcasting
0:01.286 aoe o arcane_power Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, clearcasting, crimson_chorus
0:01.286 shared_cds w potion Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus
0:01.286 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.286 aoe r arcane_missiles Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.887 aoe t arcane_barrage Fluffy_Pillow 68885.9/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.878 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.869 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.859 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.848 aoe s arcane_explosion Fluffy_Pillow 68033.8/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.840 aoe s arcane_explosion Fluffy_Pillow 66906.1/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.831 aoe s arcane_explosion Fluffy_Pillow 65776.9/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.823 aoe t arcane_barrage Fluffy_Pillow 64649.2/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.813 aoe s arcane_explosion Fluffy_Pillow 68785.3/69166: 99% mana bloodlust, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.802 aoe s arcane_explosion Fluffy_Pillow 67653.4/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.793 aoe s arcane_explosion Fluffy_Pillow 66524.2/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.783 aoe s arcane_explosion Fluffy_Pillow 65393.7/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.774 aoe p rune_of_power Fluffy_Pillow 64264.6/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.766 aoe t arcane_barrage Fluffy_Pillow 65636.8/69166: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.757 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:17.746 aoe s arcane_explosion Fluffy_Pillow 65533.8/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:18.736 aoe r arcane_missiles Fluffy_Pillow 61903.3/69166: 89% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.368 aoe s arcane_explosion Fluffy_Pillow 64160.9/69166: 93% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.358 aoe s arcane_explosion Fluffy_Pillow 60530.3/69166: 88% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.349 shared_cds v use_mana_gem dwarf 56901.2/69166: 82% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.349 aoe r arcane_missiles Fluffy_Pillow 63817.8/69166: 92% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.941 aoe t arcane_barrage Fluffy_Pillow 66020.0/69166: 95% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.931 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.922 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.911 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3)
0:27.901 aoe s arcane_explosion Fluffy_Pillow 65535.2/69166: 95% mana bloodlust, arcane_charge, crimson_chorus(3)
0:28.890 aoe s arcane_explosion Fluffy_Pillow 61903.3/69166: 89% mana bloodlust, arcane_charge(2), crimson_chorus(3)
0:29.882 aoe r arcane_missiles Fluffy_Pillow 58275.5/69166: 84% mana bloodlust, arcane_charge(3), clearcasting, crimson_chorus(3)
0:31.525 aoe s arcane_explosion Fluffy_Pillow 60548.3/69166: 88% mana bloodlust, arcane_charge(3)
0:32.515 aoe t arcane_barrage Fluffy_Pillow 56917.8/69166: 82% mana bloodlust, arcane_charge(4)
0:33.504 aoe s arcane_explosion Fluffy_Pillow 61052.5/69166: 88% mana bloodlust
0:34.494 aoe s arcane_explosion Fluffy_Pillow 57422.0/69166: 83% mana bloodlust, arcane_charge
0:35.484 aoe r arcane_missiles Fluffy_Pillow 53791.5/69166: 78% mana bloodlust, arcane_charge(2), clearcasting
0:37.055 aoe s arcane_explosion Fluffy_Pillow 55964.7/69166: 81% mana bloodlust, arcane_charge(2)
0:38.046 aoe s arcane_explosion Fluffy_Pillow 52335.5/69166: 76% mana bloodlust, arcane_charge(3)
0:39.037 aoe t arcane_barrage Fluffy_Pillow 48706.4/69166: 70% mana bloodlust, arcane_charge(4)
0:40.026 aoe s arcane_explosion Fluffy_Pillow 52841.1/69166: 76% mana bloodlust
0:41.017 aoe s arcane_explosion Fluffy_Pillow 49212.0/69166: 71% mana arcane_charge
0:42.302 aoe s arcane_explosion Fluffy_Pillow 45989.6/69166: 66% mana arcane_charge(2)
0:43.588 aoe s arcane_explosion Fluffy_Pillow 42768.5/69166: 62% mana arcane_charge(3)
0:44.873 aoe t arcane_barrage Fluffy_Pillow 39546.1/69166: 57% mana arcane_charge(4)
0:46.160 aoe q arcane_orb Fluffy_Pillow 44093.0/69166: 64% mana
0:47.447 aoe t arcane_barrage Fluffy_Pillow 45373.3/69166: 66% mana arcane_charge(4)
0:48.733 aoe s arcane_explosion Fluffy_Pillow 49918.9/69166: 72% mana
0:50.019 aoe s arcane_explosion Fluffy_Pillow 46697.9/69166: 68% mana arcane_charge
0:51.304 aoe r arcane_missiles Fluffy_Pillow 43475.4/69166: 63% mana arcane_charge(2), clearcasting
0:53.285 aoe s arcane_explosion Fluffy_Pillow 46215.8/69166: 67% mana arcane_charge(2)
0:54.570 aoe s arcane_explosion Fluffy_Pillow 42993.3/69166: 62% mana arcane_charge(3)
0:55.857 aoe t arcane_barrage Fluffy_Pillow 39773.6/69166: 58% mana arcane_charge(4)
0:57.142 aoe s arcane_explosion Fluffy_Pillow 44317.8/69166: 64% mana
0:58.427 aoe r arcane_missiles Fluffy_Pillow 41095.4/69166: 59% mana arcane_charge, clearcasting
1:00.487 aoe n touch_of_the_magi Fluffy_Pillow 43945.0/69166: 64% mana arcane_charge, crimson_chorus
1:01.774 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 43225.3/69166: 62% mana arcane_charge(4), crimson_chorus
1:01.774 aoe p rune_of_power Fluffy_Pillow 43225.3/69166: 62% mana arcane_charge(4), crimson_chorus, gladiators_badge
1:03.060 aoe t arcane_barrage Fluffy_Pillow 45004.3/69166: 65% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:04.347 aoe s arcane_explosion Fluffy_Pillow 49551.2/69166: 72% mana rune_of_power, crimson_chorus, gladiators_badge
1:05.634 aoe r arcane_missiles Fluffy_Pillow 46331.6/69166: 67% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
1:07.511 aoe s arcane_explosion Fluffy_Pillow 48928.0/69166: 71% mana arcane_charge, rune_of_power, crimson_chorus, gladiators_badge
1:08.796 aoe r arcane_missiles Fluffy_Pillow 45705.6/69166: 66% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus, gladiators_badge
1:10.789 aoe s arcane_explosion Fluffy_Pillow 48462.5/69166: 70% mana arcane_charge(2), rune_of_power, crimson_chorus(2), gladiators_badge
1:12.076 aoe s arcane_explosion Fluffy_Pillow 45242.9/69166: 65% mana arcane_charge(3), rune_of_power, crimson_chorus(2), gladiators_badge
1:13.363 aoe t arcane_barrage Fluffy_Pillow 42023.2/69166: 61% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
1:14.649 aoe q arcane_orb Fluffy_Pillow 46568.8/69166: 67% mana rune_of_power, crimson_chorus(2), gladiators_badge
1:15.936 aoe t arcane_barrage Fluffy_Pillow 47849.1/69166: 69% mana arcane_charge(4), crimson_chorus(2), gladiators_badge
1:17.223 aoe s arcane_explosion Fluffy_Pillow 52396.1/69166: 76% mana crimson_chorus(2)
1:18.508 aoe s arcane_explosion Fluffy_Pillow 49173.6/69166: 71% mana arcane_charge, crimson_chorus(2)
1:19.794 aoe s arcane_explosion Fluffy_Pillow 45952.6/69166: 66% mana arcane_charge(2), crimson_chorus(2)
1:21.083 aoe r arcane_missiles Fluffy_Pillow 42735.6/69166: 62% mana arcane_charge(3), clearcasting, crimson_chorus(3)
1:22.985 aoe s arcane_explosion Fluffy_Pillow 45366.7/69166: 66% mana arcane_charge(3), crimson_chorus(3)
1:24.272 aoe t arcane_barrage Fluffy_Pillow 42147.0/69166: 61% mana arcane_charge(4), crimson_chorus(3)
1:25.558 aoe s arcane_explosion Fluffy_Pillow 46692.6/69166: 68% mana crimson_chorus(3)
1:26.845 aoe s arcane_explosion Fluffy_Pillow 43472.9/69166: 63% mana arcane_charge, crimson_chorus(3)
1:28.132 aoe s arcane_explosion Fluffy_Pillow 40253.3/69166: 58% mana arcane_charge(2), crimson_chorus(3)
1:29.418 aoe s arcane_explosion Fluffy_Pillow 37032.2/69166: 54% mana arcane_charge(3), crimson_chorus(3)
1:30.704 aoe t arcane_barrage Fluffy_Pillow 33811.1/69166: 49% mana arcane_charge(4)
1:31.990 aoe s arcane_explosion Fluffy_Pillow 38356.7/69166: 55% mana
1:33.278 aoe s arcane_explosion Fluffy_Pillow 35138.4/69166: 51% mana arcane_charge
1:34.566 aoe s arcane_explosion Fluffy_Pillow 31920.1/69166: 46% mana arcane_charge(2)
1:35.852 aoe s arcane_explosion Fluffy_Pillow 28699.1/69166: 41% mana arcane_charge(3)
1:37.138 aoe t arcane_barrage Fluffy_Pillow 25478.0/69166: 37% mana arcane_charge(4)
1:38.425 aoe q arcane_orb Fluffy_Pillow 30025.0/69166: 43% mana
1:39.713 aoe t arcane_barrage Fluffy_Pillow 31306.7/69166: 45% mana arcane_charge(4)
1:41.000 aoe s arcane_explosion Fluffy_Pillow 35853.6/69166: 52% mana
1:42.288 aoe s arcane_explosion Fluffy_Pillow 32635.3/69166: 47% mana arcane_charge
1:43.574 aoe s arcane_explosion Fluffy_Pillow 29414.3/69166: 43% mana arcane_charge(2)
1:44.861 aoe r arcane_missiles Fluffy_Pillow 26194.6/69166: 38% mana arcane_charge(3), clearcasting
1:46.786 aoe s arcane_explosion Fluffy_Pillow 28857.5/69166: 42% mana arcane_charge(3)
1:48.074 aoe t arcane_barrage Fluffy_Pillow 25639.2/69166: 37% mana arcane_charge(4)
1:49.360 aoe n touch_of_the_magi Fluffy_Pillow 30184.8/69166: 44% mana
1:50.647 aoe p rune_of_power Fluffy_Pillow 29465.1/69166: 43% mana arcane_charge(4)
1:51.934 aoe t arcane_barrage Fluffy_Pillow 31245.4/69166: 45% mana arcane_charge(4), rune_of_power
1:53.220 aoe s arcane_explosion Fluffy_Pillow 35791.0/69166: 52% mana rune_of_power
1:54.505 aoe r arcane_missiles Fluffy_Pillow 32568.5/69166: 47% mana arcane_charge, clearcasting, rune_of_power
1:56.389 aoe s arcane_explosion Fluffy_Pillow 35174.7/69166: 51% mana arcane_charge, rune_of_power
1:57.675 aoe s arcane_explosion Fluffy_Pillow 31953.7/69166: 46% mana arcane_charge(2), rune_of_power
1:58.962 aoe r arcane_missiles Fluffy_Pillow 28734.0/69166: 42% mana arcane_charge(3), clearcasting, rune_of_power
2:00.991 aoe s arcane_explosion Fluffy_Pillow 31540.7/69166: 46% mana arcane_charge(3), rune_of_power, crimson_chorus
2:02.278 aoe t arcane_barrage Fluffy_Pillow 28321.0/69166: 41% mana arcane_charge(4), rune_of_power, crimson_chorus
2:03.564 aoe q arcane_orb Fluffy_Pillow 32866.6/69166: 48% mana rune_of_power, crimson_chorus
2:04.850 aoe o arcane_power Fluffy_Pillow 34145.6/69166: 49% mana arcane_charge(4), crimson_chorus
2:04.850 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 34145.6/69166: 49% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:04.850 aoe t arcane_barrage Fluffy_Pillow 34145.6/69166: 49% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:06.138 aoe s arcane_explosion Fluffy_Pillow 38693.9/69166: 56% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:07.426 aoe s arcane_explosion Fluffy_Pillow 37975.6/69166: 55% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:08.714 aoe s arcane_explosion Fluffy_Pillow 37257.3/69166: 54% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:09.999 aoe s arcane_explosion Fluffy_Pillow 36534.9/69166: 53% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:11.284 aoe t arcane_barrage Fluffy_Pillow 35812.4/69166: 52% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:12.571 aoe s arcane_explosion Fluffy_Pillow 40359.4/69166: 58% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.858 aoe s arcane_explosion Fluffy_Pillow 39639.7/69166: 57% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.144 aoe s arcane_explosion Fluffy_Pillow 38918.7/69166: 56% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.429 aoe s arcane_explosion Fluffy_Pillow 38196.2/69166: 55% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.717 aoe t arcane_barrage Fluffy_Pillow 37477.9/69166: 54% mana arcane_charge(4), arcane_power, crimson_chorus(2), gladiators_badge
2:19.005 aoe s arcane_explosion Fluffy_Pillow 42026.3/69166: 61% mana arcane_power, crimson_chorus(2), gladiators_badge
2:20.293 aoe s arcane_explosion Fluffy_Pillow 41308.0/69166: 60% mana arcane_charge, crimson_chorus(3)
2:21.579 aoe s arcane_explosion Fluffy_Pillow 38086.9/69166: 55% mana arcane_charge(2), crimson_chorus(3)
2:22.866 shared_cds v use_mana_gem dwarf 34867.2/69166: 50% mana arcane_charge(3), crimson_chorus(3)
2:22.866 aoe s arcane_explosion Fluffy_Pillow 41783.8/69166: 60% mana arcane_charge(3), crimson_chorus(3)
2:24.153 aoe t arcane_barrage Fluffy_Pillow 38564.1/69166: 56% mana arcane_charge(4), crimson_chorus(3)
2:25.439 aoe q arcane_orb Fluffy_Pillow 43109.7/69166: 62% mana crimson_chorus(3)
2:26.726 aoe t arcane_barrage Fluffy_Pillow 44390.0/69166: 64% mana arcane_charge(4), crimson_chorus(3)
2:28.012 aoe s arcane_explosion Fluffy_Pillow 48935.6/69166: 71% mana crimson_chorus(3)
2:29.297 aoe s arcane_explosion Fluffy_Pillow 45713.2/69166: 66% mana arcane_charge, crimson_chorus(3)
2:30.584 aoe s arcane_explosion Fluffy_Pillow 42493.5/69166: 61% mana arcane_charge(2)
2:31.870 aoe s arcane_explosion Fluffy_Pillow 39272.4/69166: 57% mana arcane_charge(3)
2:33.157 aoe t arcane_barrage Fluffy_Pillow 36052.8/69166: 52% mana arcane_charge(4)
2:34.442 aoe s arcane_explosion Fluffy_Pillow 40596.9/69166: 59% mana
2:35.728 aoe n touch_of_the_magi Fluffy_Pillow 37375.9/69166: 54% mana arcane_charge
2:37.014 aoe p rune_of_power Fluffy_Pillow 36654.8/69166: 53% mana arcane_charge(4)
2:38.301 aoe t arcane_barrage Fluffy_Pillow 38435.1/69166: 56% mana arcane_charge(4), rune_of_power
2:39.586 aoe s arcane_explosion Fluffy_Pillow 42979.3/69166: 62% mana rune_of_power
2:40.873 aoe r arcane_missiles Fluffy_Pillow 39759.7/69166: 57% mana arcane_charge, clearcasting, rune_of_power
2:42.852 aoe s arcane_explosion Fluffy_Pillow 42497.2/69166: 61% mana arcane_charge, rune_of_power
2:44.137 aoe s arcane_explosion Fluffy_Pillow 39274.8/69166: 57% mana arcane_charge(2), rune_of_power
2:45.424 aoe r arcane_missiles Fluffy_Pillow 36055.1/69166: 52% mana arcane_charge(3), clearcasting, rune_of_power
2:47.368 aoe s arcane_explosion Fluffy_Pillow 38744.3/69166: 56% mana arcane_charge(3), rune_of_power
2:48.654 aoe r arcane_missiles Fluffy_Pillow 35523.2/69166: 51% mana arcane_charge(4), clearcasting, rune_of_power
2:50.611 aoe t arcane_barrage Fluffy_Pillow 38230.4/69166: 55% mana arcane_charge(4)
2:51.898 aoe q arcane_orb Fluffy_Pillow 42777.3/69166: 62% mana
2:53.183 aoe t arcane_barrage Fluffy_Pillow 44054.9/69166: 64% mana arcane_charge(4)
2:54.469 aoe s arcane_explosion Fluffy_Pillow 48600.5/69166: 70% mana
2:55.756 aoe s arcane_explosion Fluffy_Pillow 45380.8/69166: 66% mana arcane_charge
2:57.042 aoe s arcane_explosion Fluffy_Pillow 42159.7/69166: 61% mana arcane_charge(2)
2:58.326 aoe s arcane_explosion Fluffy_Pillow 38935.9/69166: 56% mana arcane_charge(3)
2:59.613 aoe t arcane_barrage Fluffy_Pillow 35716.2/69166: 52% mana arcane_charge(4)
3:00.900 aoe s arcane_explosion Fluffy_Pillow 40263.2/69166: 58% mana
3:02.186 aoe s arcane_explosion Fluffy_Pillow 37042.1/69166: 54% mana arcane_charge, crimson_chorus
3:03.471 aoe s arcane_explosion Fluffy_Pillow 33819.7/69166: 49% mana arcane_charge(2), crimson_chorus
3:04.755 aoe s arcane_explosion Fluffy_Pillow 30595.9/69166: 44% mana arcane_charge(3), crimson_chorus
3:06.042 aoe r arcane_missiles Fluffy_Pillow 27376.2/69166: 40% mana arcane_charge(4), clearcasting, crimson_chorus
3:08.013 aoe t arcane_barrage Fluffy_Pillow 30102.7/69166: 44% mana arcane_charge(4), crimson_chorus
3:09.300 aoe s arcane_explosion Fluffy_Pillow 34649.7/69166: 50% mana crimson_chorus
3:10.587 aoe s arcane_explosion Fluffy_Pillow 31430.0/69166: 45% mana arcane_charge, crimson_chorus
3:11.873 aoe s arcane_explosion Fluffy_Pillow 28208.9/69166: 41% mana arcane_charge(2), crimson_chorus(2)
3:13.160 aoe s arcane_explosion Fluffy_Pillow 24989.2/69166: 36% mana arcane_charge(3), crimson_chorus(2)
3:14.446 aoe t arcane_barrage Fluffy_Pillow 21768.2/69166: 31% mana arcane_charge(4), crimson_chorus(2)
3:15.732 aoe q arcane_orb Fluffy_Pillow 26313.8/69166: 38% mana crimson_chorus(2)
3:17.018 aoe t arcane_barrage Fluffy_Pillow 27592.7/69166: 40% mana arcane_charge(4), crimson_chorus(2)
3:18.305 aoe s arcane_explosion Fluffy_Pillow 32139.7/69166: 46% mana crimson_chorus(2)
3:19.593 aoe s arcane_explosion Fluffy_Pillow 28921.4/69166: 42% mana arcane_charge, crimson_chorus(2)
3:20.878 aoe s arcane_explosion Fluffy_Pillow 25698.9/69166: 37% mana arcane_charge(2), crimson_chorus(2)
3:22.165 aoe s arcane_explosion Fluffy_Pillow 22479.2/69166: 33% mana arcane_charge(3), crimson_chorus(3)
3:23.452 aoe t arcane_barrage Fluffy_Pillow 19259.6/69166: 28% mana arcane_charge(4), crimson_chorus(3)
3:24.739 aoe n touch_of_the_magi Fluffy_Pillow 23806.5/69166: 34% mana crimson_chorus(3)
3:26.026 aoe p rune_of_power Fluffy_Pillow 23086.9/69166: 33% mana arcane_charge(4), clearcasting, crimson_chorus(3)
3:27.312 aoe r arcane_missiles Fluffy_Pillow 24865.8/69166: 36% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3)
3:29.410 aoe t arcane_barrage Fluffy_Pillow 27768.0/69166: 40% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:30.698 aoe s arcane_explosion Fluffy_Pillow 32316.3/69166: 47% mana rune_of_power, crimson_chorus(3)
3:31.987 aoe s arcane_explosion Fluffy_Pillow 29099.4/69166: 42% mana arcane_charge, rune_of_power
3:33.273 aoe s arcane_explosion Fluffy_Pillow 25878.4/69166: 37% mana arcane_charge(2), rune_of_power
3:34.560 aoe r arcane_missiles Fluffy_Pillow 22658.7/69166: 33% mana arcane_charge(3), clearcasting, rune_of_power
3:36.659 aoe s arcane_explosion Fluffy_Pillow 25562.3/69166: 37% mana arcane_charge(3), rune_of_power
3:37.946 aoe r arcane_missiles Fluffy_Pillow 22342.6/69166: 32% mana arcane_charge(4), clearcasting, rune_of_power
3:39.884 aoe t arcane_barrage Fluffy_Pillow 25023.5/69166: 36% mana arcane_charge(4)
3:41.169 aoe q arcane_orb Fluffy_Pillow 29567.6/69166: 43% mana
3:42.456 aoe t arcane_barrage Fluffy_Pillow 30848.0/69166: 45% mana arcane_charge(4)
3:43.744 aoe s arcane_explosion Fluffy_Pillow 35396.3/69166: 51% mana
3:45.030 aoe s arcane_explosion Fluffy_Pillow 32175.2/69166: 47% mana arcane_charge
3:46.317 aoe s arcane_explosion Fluffy_Pillow 28955.6/69166: 42% mana arcane_charge(2)
3:47.603 aoe s arcane_explosion Fluffy_Pillow 25734.5/69166: 37% mana arcane_charge(3)
3:48.890 aoe t arcane_barrage Fluffy_Pillow 22514.8/69166: 33% mana arcane_charge(4)
3:50.175 aoe s arcane_explosion Fluffy_Pillow 27059.0/69166: 39% mana
3:51.460 aoe r arcane_missiles Fluffy_Pillow 23836.6/69166: 34% mana arcane_charge, clearcasting
3:53.501 aoe s arcane_explosion Fluffy_Pillow 26659.9/69166: 39% mana arcane_charge
3:54.788 aoe r arcane_missiles Fluffy_Pillow 23440.3/69166: 34% mana arcane_charge(2), clearcasting
3:56.830 aoe s arcane_explosion Fluffy_Pillow 26265.0/69166: 38% mana arcane_charge(2)
3:58.117 aoe r arcane_missiles Fluffy_Pillow 23045.3/69166: 33% mana arcane_charge(3), clearcasting
4:00.096 aoe s arcane_explosion Fluffy_Pillow 25782.9/69166: 37% mana arcane_charge(3)
4:01.384 aoe t arcane_barrage Fluffy_Pillow 22564.6/69166: 33% mana arcane_charge(4)
4:02.671 aoe q arcane_orb Fluffy_Pillow 27111.5/69166: 39% mana crimson_chorus
4:03.958 aoe t arcane_barrage Fluffy_Pillow 28391.9/69166: 41% mana arcane_charge(4), crimson_chorus
4:05.245 aoe s arcane_explosion Fluffy_Pillow 32938.8/69166: 48% mana crimson_chorus
4:06.530 aoe s arcane_explosion Fluffy_Pillow 29716.4/69166: 43% mana arcane_charge, crimson_chorus
4:07.816 aoe s arcane_explosion Fluffy_Pillow 26495.3/69166: 38% mana arcane_charge(2), crimson_chorus
4:09.102 aoe s arcane_explosion Fluffy_Pillow 23274.3/69166: 34% mana arcane_charge(3), crimson_chorus
4:10.390 aoe t arcane_barrage Fluffy_Pillow 20056.0/69166: 29% mana arcane_charge(4), crimson_chorus
4:11.677 aoe n touch_of_the_magi Fluffy_Pillow 24602.9/69166: 36% mana crimson_chorus
4:12.965 aoe o arcane_power Fluffy_Pillow 23884.6/69166: 35% mana arcane_charge(4), crimson_chorus(2)
4:12.965 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 23884.6/69166: 35% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:12.965 aoe t arcane_barrage Fluffy_Pillow 23884.6/69166: 35% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:14.251 aoe s arcane_explosion Fluffy_Pillow 28430.2/69166: 41% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:15.539 aoe s arcane_explosion Fluffy_Pillow 27711.9/69166: 40% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:16.826 aoe s arcane_explosion Fluffy_Pillow 26992.2/69166: 39% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.112 aoe s arcane_explosion Fluffy_Pillow 26271.2/69166: 38% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.397 aoe t arcane_barrage Fluffy_Pillow 25548.7/69166: 37% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.684 aoe s arcane_explosion Fluffy_Pillow 30095.7/69166: 44% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.971 aoe s arcane_explosion Fluffy_Pillow 29376.0/69166: 42% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:23.257 shared_cds v use_mana_gem dwarf 28655.0/69166: 41% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:23.257 aoe s arcane_explosion Fluffy_Pillow 35571.5/69166: 51% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:24.543 aoe s arcane_explosion Fluffy_Pillow 34850.5/69166: 50% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.830 aoe p rune_of_power Fluffy_Pillow 34130.8/69166: 49% mana arcane_charge(4), arcane_power, clearcasting, crimson_chorus(3), gladiators_badge
4:27.116 aoe r arcane_missiles Fluffy_Pillow 35909.8/69166: 52% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
4:29.088 aoe t arcane_barrage Fluffy_Pillow 38637.6/69166: 56% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:30.374 aoe q arcane_orb Fluffy_Pillow 43183.2/69166: 62% mana rune_of_power, crimson_chorus(3)
4:31.660 aoe t arcane_barrage Fluffy_Pillow 44462.2/69166: 64% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:32.946 aoe s arcane_explosion Fluffy_Pillow 49007.7/69166: 71% mana rune_of_power
4:34.232 aoe s arcane_explosion Fluffy_Pillow 45786.7/69166: 66% mana arcane_charge, rune_of_power
4:35.519 aoe s arcane_explosion Fluffy_Pillow 42567.0/69166: 62% mana arcane_charge(2), rune_of_power
4:36.804 aoe r arcane_missiles Fluffy_Pillow 39344.6/69166: 57% mana arcane_charge(3), clearcasting, rune_of_power
4:38.813 aoe s arcane_explosion Fluffy_Pillow 42123.6/69166: 61% mana arcane_charge(3), rune_of_power
4:40.099 aoe t arcane_barrage Fluffy_Pillow 38902.6/69166: 56% mana arcane_charge(4)
4:41.385 aoe s arcane_explosion Fluffy_Pillow 43448.1/69166: 63% mana
4:42.672 aoe s arcane_explosion Fluffy_Pillow 40228.5/69166: 58% mana arcane_charge
4:43.960 aoe s arcane_explosion Fluffy_Pillow 37010.2/69166: 54% mana arcane_charge(2)
4:45.248 aoe s arcane_explosion Fluffy_Pillow 33791.9/69166: 49% mana arcane_charge(3)
4:46.535 aoe r arcane_missiles Fluffy_Pillow 30572.2/69166: 44% mana arcane_charge(4), clearcasting
4:48.518 aoe t arcane_barrage Fluffy_Pillow 33315.3/69166: 48% mana arcane_charge(4)
4:49.805 aoe s arcane_explosion Fluffy_Pillow 37862.3/69166: 55% mana
4:51.090 aoe s arcane_explosion Fluffy_Pillow 34639.8/69166: 50% mana arcane_charge
4:52.377 aoe s arcane_explosion Fluffy_Pillow 31420.2/69166: 45% mana arcane_charge(2)
4:53.663 aoe s arcane_explosion Fluffy_Pillow 28199.1/69166: 41% mana arcane_charge(3)
4:54.948 aoe t arcane_barrage Fluffy_Pillow 24976.7/69166: 36% mana arcane_charge(4)
4:56.235 aoe q arcane_orb Fluffy_Pillow 29523.6/69166: 43% mana
4:57.521 aoe t arcane_barrage Fluffy_Pillow 30802.6/69166: 45% mana arcane_charge(4)
4:58.806 aoe s arcane_explosion Fluffy_Pillow 35346.8/69166: 51% mana
5:00.091 aoe s arcane_explosion Fluffy_Pillow 32124.3/69166: 46% mana arcane_charge
5:01.377 aoe s arcane_explosion Fluffy_Pillow 28903.3/69166: 42% mana arcane_charge(2)

Stats

Level Bonus (60) Race Bonus (dwarf) Raid-Buffed Unbuffed Gear Amount
Strength 198 2 200 200 0
Agility 306 -2 304 304 0
Stamina 414 1 2028 1932 1517
Intellect 450 -1 1794 1614 1089 (46)
Spirit 0 0 0 0 0
Health 40560 38640 0
Mana 69166 69166 0
Spell Power 1794 1614 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="dwarf"
source=default
spec=arcane
level=60
race=dwarf
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

gnome : 8906 dps, 4556 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8906.4 8906.4 16.2 / 0.182% 1101.8 / 12.4% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2069.7 1950.8 Mana 0.00% 48.4 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
gnome 8906
Arcane Barrage 3742 42.0% 50.5 5.97sec 22299 18206 Direct 151.2 6312 12911 7443 17.1%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.47 151.25 0.00 0.00 1.2249 0.0000 1125525.24 1125525.24 0.00% 18205.90 18205.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.85% 125.31 87 159 6311.58 2177 30774 6303.61 5508 7062 790686 790686 0.00%
crit 17.15% 25.94 10 43 12911.29 4354 61548 12892.27 7115 19797 334839 334839 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.46
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 912 1824 1047 14.8%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1047.44 1047.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.15% 0.85 0 1 912.02 912 912 776.61 0 912 777 777 0.00%
crit 14.85% 0.15 0 1 1824.05 1824 1824 270.83 0 1824 271 271 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2941 33.0% 131.1 2.26sec 6739 5520 Direct 393.4 1902 3904 2246 17.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 131.14 393.42 0.00 0.00 1.2207 0.0000 883733.94 883733.94 0.00% 5520.40 5520.40
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.78% 325.68 245 415 1901.69 1455 3577 1902.08 1778 2027 619250 619250 0.00%
crit 17.22% 67.74 39 102 3904.47 2910 7154 3905.21 3372 4483 264484 264484 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:131.13
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1021 11.5% 24.8 11.64sec 12367 6579 Periodic 197.8 1316 2689 1551 17.2% 4.5%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.81 0.00 197.92 197.79 1.8797 0.2040 306848.47 306848.47 0.00% 6579.08 6579.08
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.83% 163.83 74 257 1315.53 1066 2622 1315.59 1105 1577 215542 215542 0.00%
crit 17.17% 33.96 13 64 2688.79 2133 5244 2687.23 2177 3623 91307 91307 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.83
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (598) 0.0% (6.7%) 12.8 24.14sec 14001 11403

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.84 0.00 0.00 0.00 1.2279 0.0000 0.00 0.00 0.00% 11403.10 11403.10

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.84
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 598 6.7% 38.5 24.14sec 4673 0 Direct 38.5 3962 8108 4676 17.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.48 38.48 0.00 0.00 0.0000 0.0000 179838.29 179838.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.80% 31.86 19 43 3962.01 2875 7070 3959.42 3298 4623 126181 126181 0.00%
crit 17.20% 6.62 0 15 8107.50 5751 14139 8081.45 0 13339 53658 53658 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 14.0 1.77sec 507 0 Periodic 40.4 (42.3) 111 0 111 0.0% (0.0%) 4.4%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.02 0.00 40.38 40.38 0.0000 0.9870 4501.03 4501.03 0.00% 178.44 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.38 15 64 111.47 0 202 111.55 67 167 4501 4501 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 2.0 9.66sec 1329 0 Direct 2.0 1115 2232 1329 19.2%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.96 1.96 0.00 0.00 0.0000 0.0000 2609.88 2609.88 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.83% 1.59 0 3 1114.51 1093 1158 1047.11 0 1158 1770 1770 0.00%
crit 19.17% 0.38 0 3 2231.74 2185 2316 744.24 0 2316 840 840 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.3 14.29sec 530 0 Direct 20.3 452 905 529 17.1%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.28 20.28 0.00 0.00 0.0000 0.0000 10742.15 10742.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.88% 16.81 7 28 452.12 444 470 452.15 444 464 7600 7600 0.00%
crit 17.12% 3.47 0 9 904.52 887 941 878.67 0 941 3142 3142 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4097 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 102  / 14 0.2% 90.0 1.30sec 46 35 Direct 90.0 38 78 46 18.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3140 0.0000 4096.84 4096.84 0.00% 34.64 34.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.81% 73.63 63 86 38.34 30 46 38.34 37 40 2823 2823 0.00%
crit 18.19% 16.37 4 27 77.81 59 92 77.79 67 89 1274 1274 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (528) 0.0% (5.9%) 6.2 51.78sec 25487 20014

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 0.00 0.00 0.00 1.2735 0.0000 0.00 0.00 0.00% 20014.11 20014.11

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.24
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 528 5.9% 6.2 51.66sec 25487 0 Direct 18.6 8518 0 8518 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 18.61 0.00 0.00 0.0000 0.0000 158551.76 158551.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.61 15 21 8518.09 476 42956 8513.37 5844 12040 158552 158552 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12642.84
  • base_dd_max:12642.84
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
gnome
Arcane Power 2.9 126.89sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.88
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.4 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.37 0.00 2.17 0.00 4.1623 0.7030 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:gnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.37
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:gnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:gnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [x]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.08sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.07 0.00 0.00 0.00 1.2252 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.10
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 122.22sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:gnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [w]:2.77
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 51.3 138.4 5.9sec 1.6sec 4.6sec 78.07% 0.00% 3.0 (4.4) 0.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 17.5s
  • trigger_min/max:0.0s / 8.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.2s

Stack Uptimes

  • arcane_charge_1:20.61%
  • arcane_charge_2:17.94%
  • arcane_charge_3:16.79%
  • arcane_charge_4:22.73%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 126.9sec 126.9sec 14.7sec 14.10% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 138.2s
  • trigger_min/max:120.0s / 138.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.10%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 25.0 0.0 11.6sec 11.6sec 1.3sec 10.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.55%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.03% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 67.6s
  • trigger_min/max:60.0s / 67.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.32%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.4 0.0 0.0sec 0.0sec 4.3sec 0.53% 0.00% 1.5 (1.5) 0.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.9s

Stack Uptimes

  • evocation_1:0.54%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 4.0 0.0 84.2sec 84.2sec 14.6sec 19.55% 0.00% 0.0 (0.0) 3.8

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 138.2s
  • trigger_min/max:60.0s / 138.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.55%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.8sec 34.8sec 11.8sec 35.14% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 60.4s
  • trigger_min/max:12.0s / 60.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.14%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.77% 0.75% 6.42% 0.9s 0.0s 5.2s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation230.41693.956354.621277.967150.296359.985
Rune of Power5.9420.00032.33637.63916.37174.666
Touch of the Magi4.6240.00038.32630.56114.81575.597
Arcane Power4.9770.00018.21314.4801.35631.418
Arcane Barrage3.4920.00413.916178.002136.645218.266
Arcane Orb4.0280.00019.32252.27626.36581.436

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
gnome
mana_regen Mana 1051.63 406827.16 69.35% 386.85 8659.85 2.08%
Evocation Mana 17.54 19767.40 3.37% 1127.29 0.00 0.00%
Mana Gem Mana 2.77 20134.91 3.43% 7262.40 0.00 0.00%
Arcane Barrage Mana 50.46 139924.43 23.85% 2772.86 6665.90 4.55%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 71249.0 1950.78 2069.66 15315.2 36865.8 372.9 72624.0
Usage Type Count Total Avg RPE APR
gnome
arcane_explosion Mana 131.1 599673.7 4573.1 4572.8 1.5
arcane_orb Mana 12.8 5857.4 456.2 456.0 30.7
touch_of_the_magi Mana 6.2 15539.0 2499.1 2497.9 10.2

Statistics & Data Analysis

Fight Length
gnome Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
gnome Damage Per Second
Count 1118
Mean 8906.40
Minimum 8132.48
Maximum 9892.23
Spread ( max - min ) 1759.74
Range [ ( max - min ) / 2 * 100% ] 9.88%
Standard Deviation 276.3220
5th Percentile 8479.85
95th Percentile 9408.72
( 95th Percentile - 5th Percentile ) 928.87
Mean Distribution
Standard Deviation 8.2641
95.00% Confidence Interval ( 8890.20 - 8922.60 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3698
0.1 Scale Factor Error with Delta=300 652
0.05 Scale Factor Error with Delta=300 2608
0.01 Scale Factor Error with Delta=300 65181
Priority Target DPS
gnome Priority Target Damage Per Second
Count 1118
Mean 4556.43
Minimum 3925.16
Maximum 5271.43
Spread ( max - min ) 1346.27
Range [ ( max - min ) / 2 * 100% ] 14.77%
Standard Deviation 200.3990
5th Percentile 4248.76
95th Percentile 4912.91
( 95th Percentile - 5th Percentile ) 664.15
Mean Distribution
Standard Deviation 5.9934
95.00% Confidence Interval ( 4544.68 - 4568.18 )
Normalized 95.00% Confidence Interval ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7431
0.1 Scale Factor Error with Delta=300 343
0.05 Scale Factor Error with Delta=300 1372
0.01 Scale Factor Error with Delta=300 34283
DPS(e)
gnome Damage Per Second (Effective)
Count 1118
Mean 8906.40
Minimum 8132.48
Maximum 9892.23
Spread ( max - min ) 1759.74
Range [ ( max - min ) / 2 * 100% ] 9.88%
Damage
gnome Damage
Count 1118
Mean 2673398.18
Minimum 2003412.49
Maximum 3347558.13
Spread ( max - min ) 1344145.64
Range [ ( max - min ) / 2 * 100% ] 25.14%
DTPS
gnome Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
gnome Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
gnome Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
gnome Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
gnome Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
gnome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
gnomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
gnome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.24 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.88 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.10 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.84 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.83 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 131.13 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.46 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.37 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation
# count action,conditions
0.00 variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
v 0.09 cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
0.00 evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
0.00 evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
0.00 strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
0.00 arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
0.00 arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
0.00 arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
0.00 arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
0.00 arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
0.00 arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
0.00 arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
0.00 arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
0.00 supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
0.00 arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
0.00 arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
0.00 arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 arcane_blast
0.00 evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
0.00 arcane_barrage
actions.shared_cds
# count action,conditions
w 2.77 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
x 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
y 4.03 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnoxytqtssssrtssssptssswrstqtsssrstsssstssssrtqtsssstsrssstnyptqtssrsstsssstsssstqtsssstsssstssrnptqtsssstssssoyrtsssrstqtwsssstsssstssnprtqrtsrssrstsssstqtssssrtsssustnptqtsssrstsssstssrsstqtsssstsssstssnoytqtsssswtssssptsssstqtsssstssssrtsssstqts

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat T flask gnome 72624.0/72624: 100% mana
Pre precombat U food gnome 72624.0/72624: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 72624.0/72624: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 72624.0/72624: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 71249.0/72624: 98% mana
0:01.273 aoe o arcane_power Fluffy_Pillow 70129.5/72624: 97% mana bloodlust, crimson_chorus
0:01.273 shared_cds x potion Fluffy_Pillow 70129.5/72624: 97% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:01.273 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 70129.5/72624: 97% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.273 aoe t arcane_barrage Fluffy_Pillow 70129.5/72624: 97% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.255 aoe q arcane_orb Fluffy_Pillow 72624.0/72624: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.234 aoe t arcane_barrage Fluffy_Pillow 72624.0/72624: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.216 aoe s arcane_explosion Fluffy_Pillow 72624.0/72624: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.197 aoe s arcane_explosion Fluffy_Pillow 71481.0/72624: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.178 aoe s arcane_explosion Fluffy_Pillow 70338.1/72624: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.160 aoe s arcane_explosion Fluffy_Pillow 69196.5/72624: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.141 aoe r arcane_missiles Fluffy_Pillow 68053.5/72624: 94% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.754 aoe t arcane_barrage Fluffy_Pillow 70284.8/72624: 97% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.735 aoe s arcane_explosion Fluffy_Pillow 72624.0/72624: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.714 aoe s arcane_explosion Fluffy_Pillow 71478.3/72624: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.694 aoe s arcane_explosion Fluffy_Pillow 70333.9/72624: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.675 aoe s arcane_explosion Fluffy_Pillow 69190.9/72624: 95% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.655 aoe p rune_of_power Fluffy_Pillow 68046.6/72624: 94% mana bloodlust, arcane_charge(4), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.636 aoe t arcane_barrage Fluffy_Pillow 69403.6/72624: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.617 aoe s arcane_explosion Fluffy_Pillow 72624.0/72624: 100% mana bloodlust, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:17.600 aoe s arcane_explosion Fluffy_Pillow 68983.8/72624: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:18.579 aoe s arcane_explosion Fluffy_Pillow 65338.1/72624: 90% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.560 shared_cds w use_mana_gem gnome 61695.1/72624: 85% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.560 aoe r arcane_missiles Fluffy_Pillow 68957.5/72624: 95% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:21.169 aoe s arcane_explosion Fluffy_Pillow 71183.2/72624: 98% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.149 aoe t arcane_barrage Fluffy_Pillow 67538.9/72624: 93% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.130 aoe q arcane_orb Fluffy_Pillow 71800.9/72624: 99% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.111 aoe t arcane_barrage Fluffy_Pillow 72624.0/72624: 100% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.091 aoe s arcane_explosion Fluffy_Pillow 72624.0/72624: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.072 aoe s arcane_explosion Fluffy_Pillow 68981.0/72624: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.054 aoe s arcane_explosion Fluffy_Pillow 65339.4/72624: 90% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3)
0:28.034 aoe r arcane_missiles Fluffy_Pillow 61695.1/72624: 85% mana bloodlust, arcane_charge(3), clearcasting, crimson_chorus(3)
0:29.671 aoe s arcane_explosion Fluffy_Pillow 63959.6/72624: 88% mana bloodlust, arcane_charge(3), crimson_chorus(3)
0:30.652 aoe t arcane_barrage Fluffy_Pillow 60316.6/72624: 83% mana bloodlust, arcane_charge(4)
0:31.633 aoe s arcane_explosion Fluffy_Pillow 64578.6/72624: 89% mana bloodlust
0:32.615 aoe s arcane_explosion Fluffy_Pillow 60937.0/72624: 84% mana bloodlust, arcane_charge
0:33.597 aoe s arcane_explosion Fluffy_Pillow 57295.4/72624: 79% mana bloodlust, arcane_charge(2)
0:34.577 aoe s arcane_explosion Fluffy_Pillow 53651.1/72624: 74% mana bloodlust, arcane_charge(3)
0:35.557 aoe t arcane_barrage Fluffy_Pillow 50006.7/72624: 69% mana bloodlust, arcane_charge(4)
0:36.539 aoe s arcane_explosion Fluffy_Pillow 54270.1/72624: 75% mana bloodlust
0:37.520 aoe s arcane_explosion Fluffy_Pillow 50627.1/72624: 70% mana bloodlust, arcane_charge
0:38.501 aoe s arcane_explosion Fluffy_Pillow 46984.2/72624: 65% mana bloodlust, arcane_charge(2)
0:39.482 aoe s arcane_explosion Fluffy_Pillow 43341.2/72624: 60% mana bloodlust, arcane_charge(3)
0:40.463 aoe r arcane_missiles Fluffy_Pillow 39698.2/72624: 55% mana bloodlust, arcane_charge(4), clearcasting
0:42.077 aoe t arcane_barrage Fluffy_Pillow 41930.9/72624: 58% mana arcane_charge(4)
0:43.352 aoe q arcane_orb Fluffy_Pillow 46599.6/72624: 64% mana
0:44.627 aoe t arcane_barrage Fluffy_Pillow 47863.3/72624: 66% mana arcane_charge(4)
0:45.900 aoe s arcane_explosion Fluffy_Pillow 52529.2/72624: 72% mana
0:47.172 aoe s arcane_explosion Fluffy_Pillow 49288.8/72624: 68% mana arcane_charge
0:48.446 aoe s arcane_explosion Fluffy_Pillow 46051.1/72624: 63% mana arcane_charge(2)
0:49.719 aoe s arcane_explosion Fluffy_Pillow 42812.1/72624: 59% mana arcane_charge(3)
0:50.993 aoe t arcane_barrage Fluffy_Pillow 39574.4/72624: 54% mana arcane_charge(4)
0:52.267 aoe s arcane_explosion Fluffy_Pillow 44241.7/72624: 61% mana
0:53.541 aoe r arcane_missiles Fluffy_Pillow 41004.1/72624: 56% mana arcane_charge, clearcasting
0:55.367 aoe s arcane_explosion Fluffy_Pillow 43530.0/72624: 60% mana arcane_charge
0:56.641 aoe s arcane_explosion Fluffy_Pillow 40292.4/72624: 55% mana arcane_charge(2)
0:57.916 aoe s arcane_explosion Fluffy_Pillow 37056.1/72624: 51% mana arcane_charge(3)
0:59.189 aoe t arcane_barrage Fluffy_Pillow 33817.1/72624: 47% mana arcane_charge(4)
1:00.464 aoe n touch_of_the_magi Fluffy_Pillow 38485.7/72624: 53% mana
1:01.739 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 37749.5/72624: 52% mana arcane_charge(4)
1:01.739 aoe p rune_of_power Fluffy_Pillow 37749.5/72624: 52% mana arcane_charge(4), gladiators_badge
1:03.013 aoe t arcane_barrage Fluffy_Pillow 39511.8/72624: 54% mana arcane_charge(4), rune_of_power, gladiators_badge
1:04.287 aoe q arcane_orb Fluffy_Pillow 44179.1/72624: 61% mana rune_of_power, crimson_chorus, gladiators_badge
1:05.560 aoe t arcane_barrage Fluffy_Pillow 45440.1/72624: 63% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:06.835 aoe s arcane_explosion Fluffy_Pillow 50108.8/72624: 69% mana rune_of_power, crimson_chorus, gladiators_badge
1:08.108 aoe s arcane_explosion Fluffy_Pillow 46869.7/72624: 65% mana arcane_charge, rune_of_power, crimson_chorus, gladiators_badge
1:09.381 aoe r arcane_missiles Fluffy_Pillow 43630.7/72624: 60% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus, gladiators_badge
1:11.326 aoe s arcane_explosion Fluffy_Pillow 46321.2/72624: 64% mana arcane_charge(2), rune_of_power, crimson_chorus, gladiators_badge
1:12.599 aoe s arcane_explosion Fluffy_Pillow 43082.2/72624: 59% mana arcane_charge(3), rune_of_power, crimson_chorus, gladiators_badge
1:13.872 aoe t arcane_barrage Fluffy_Pillow 39843.1/72624: 55% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
1:15.144 aoe s arcane_explosion Fluffy_Pillow 44507.7/72624: 61% mana crimson_chorus(2), gladiators_badge
1:16.419 aoe s arcane_explosion Fluffy_Pillow 41271.4/72624: 57% mana arcane_charge, crimson_chorus(2), gladiators_badge
1:17.693 aoe s arcane_explosion Fluffy_Pillow 38033.7/72624: 52% mana arcane_charge(2), crimson_chorus(2)
1:18.967 aoe s arcane_explosion Fluffy_Pillow 34796.1/72624: 48% mana arcane_charge(3), crimson_chorus(2)
1:20.241 aoe t arcane_barrage Fluffy_Pillow 31558.4/72624: 43% mana arcane_charge(4), crimson_chorus(2)
1:21.515 aoe s arcane_explosion Fluffy_Pillow 36225.7/72624: 50% mana crimson_chorus(2)
1:22.788 aoe s arcane_explosion Fluffy_Pillow 32986.7/72624: 45% mana arcane_charge, crimson_chorus(2)
1:24.060 aoe s arcane_explosion Fluffy_Pillow 29746.3/72624: 41% mana arcane_charge(2), crimson_chorus(3)
1:25.333 aoe s arcane_explosion Fluffy_Pillow 26507.2/72624: 36% mana arcane_charge(3), crimson_chorus(3)
1:26.608 aoe t arcane_barrage Fluffy_Pillow 23270.9/72624: 32% mana arcane_charge(4), crimson_chorus(3)
1:27.881 aoe q arcane_orb Fluffy_Pillow 27936.9/72624: 38% mana crimson_chorus(3)
1:29.156 aoe t arcane_barrage Fluffy_Pillow 29200.6/72624: 40% mana arcane_charge(4), crimson_chorus(3)
1:30.429 aoe s arcane_explosion Fluffy_Pillow 33866.5/72624: 47% mana crimson_chorus(3)
1:31.703 aoe s arcane_explosion Fluffy_Pillow 30628.9/72624: 42% mana arcane_charge, crimson_chorus(3)
1:32.975 aoe s arcane_explosion Fluffy_Pillow 27388.4/72624: 38% mana arcane_charge(2), crimson_chorus(3)
1:34.248 aoe s arcane_explosion Fluffy_Pillow 24149.4/72624: 33% mana arcane_charge(3)
1:35.523 aoe t arcane_barrage Fluffy_Pillow 20913.1/72624: 29% mana arcane_charge(4)
1:36.799 aoe s arcane_explosion Fluffy_Pillow 25583.2/72624: 35% mana
1:38.071 aoe s arcane_explosion Fluffy_Pillow 22342.8/72624: 31% mana arcane_charge
1:39.344 aoe s arcane_explosion Fluffy_Pillow 19103.7/72624: 26% mana arcane_charge(2)
1:40.618 aoe s arcane_explosion Fluffy_Pillow 15866.1/72624: 22% mana arcane_charge(3)
1:41.891 aoe t arcane_barrage Fluffy_Pillow 12627.0/72624: 17% mana arcane_charge(4)
1:43.165 aoe s arcane_explosion Fluffy_Pillow 17294.3/72624: 24% mana
1:44.438 aoe s arcane_explosion Fluffy_Pillow 14055.3/72624: 19% mana arcane_charge
1:45.711 aoe r arcane_missiles Fluffy_Pillow 10816.2/72624: 15% mana arcane_charge(2), clearcasting
1:47.535 aoe n touch_of_the_magi Fluffy_Pillow 13339.4/72624: 18% mana arcane_charge(2)
1:48.808 aoe p rune_of_power Fluffy_Pillow 12600.4/72624: 17% mana arcane_charge(4)
1:50.082 aoe t arcane_barrage Fluffy_Pillow 14362.7/72624: 20% mana arcane_charge(4), rune_of_power
1:51.354 aoe q arcane_orb Fluffy_Pillow 19027.2/72624: 26% mana rune_of_power
1:52.627 aoe t arcane_barrage Fluffy_Pillow 20288.2/72624: 28% mana arcane_charge(4), rune_of_power
1:53.902 aoe s arcane_explosion Fluffy_Pillow 24956.9/72624: 34% mana rune_of_power
1:55.177 aoe s arcane_explosion Fluffy_Pillow 21720.6/72624: 30% mana arcane_charge, rune_of_power
1:56.449 aoe s arcane_explosion Fluffy_Pillow 18480.2/72624: 25% mana arcane_charge(2), rune_of_power
1:57.722 aoe s arcane_explosion Fluffy_Pillow 15241.1/72624: 21% mana arcane_charge(3), rune_of_power
1:58.994 aoe t arcane_barrage Fluffy_Pillow 12000.7/72624: 17% mana arcane_charge(4), rune_of_power
2:00.266 aoe s arcane_explosion Fluffy_Pillow 16665.3/72624: 23% mana rune_of_power
2:01.538 aoe s arcane_explosion Fluffy_Pillow 13424.8/72624: 18% mana arcane_charge, rune_of_power
2:02.811 aoe s arcane_explosion Fluffy_Pillow 10185.8/72624: 14% mana arcane_charge(2)
2:04.085 aoe s arcane_explosion Fluffy_Pillow 6948.1/72624: 10% mana arcane_charge(3)
2:05.355 aoe o arcane_power Fluffy_Pillow 3704.9/72624: 5% mana arcane_charge(4), clearcasting, crimson_chorus
2:05.355 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 3704.9/72624: 5% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus
2:05.355 aoe r arcane_missiles Fluffy_Pillow 3704.9/72624: 5% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
2:07.308 aoe t arcane_barrage Fluffy_Pillow 6406.6/72624: 9% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:08.581 aoe s arcane_explosion Fluffy_Pillow 11072.5/72624: 15% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:09.856 aoe s arcane_explosion Fluffy_Pillow 10336.2/72624: 14% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:11.129 aoe s arcane_explosion Fluffy_Pillow 9597.2/72624: 13% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:12.403 aoe r arcane_missiles Fluffy_Pillow 8859.5/72624: 12% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
2:14.344 aoe s arcane_explosion Fluffy_Pillow 11544.5/72624: 16% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.617 aoe t arcane_barrage Fluffy_Pillow 10805.5/72624: 15% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.888 aoe q arcane_orb Fluffy_Pillow 15468.6/72624: 21% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.161 aoe t arcane_barrage Fluffy_Pillow 16979.6/72624: 23% mana arcane_charge(4), arcane_power, crimson_chorus(2), gladiators_badge
2:19.435 shared_cds w use_mana_gem gnome 21646.9/72624: 30% mana arcane_power, crimson_chorus(2), gladiators_badge
2:19.560 aoe s arcane_explosion Fluffy_Pillow 29082.2/72624: 40% mana arcane_power, crimson_chorus(2), gladiators_badge
2:20.834 aoe s arcane_explosion Fluffy_Pillow 28344.5/72624: 39% mana arcane_charge, crimson_chorus(2)
2:22.107 aoe s arcane_explosion Fluffy_Pillow 25105.5/72624: 35% mana arcane_charge(2), crimson_chorus(2)
2:23.381 aoe s arcane_explosion Fluffy_Pillow 21867.8/72624: 30% mana arcane_charge(3), crimson_chorus(2)
2:24.654 aoe t arcane_barrage Fluffy_Pillow 18628.8/72624: 26% mana arcane_charge(4), crimson_chorus(3)
2:25.929 aoe s arcane_explosion Fluffy_Pillow 23297.5/72624: 32% mana crimson_chorus(3)
2:27.203 aoe s arcane_explosion Fluffy_Pillow 20059.8/72624: 28% mana arcane_charge, crimson_chorus(3)
2:28.478 aoe s arcane_explosion Fluffy_Pillow 16823.6/72624: 23% mana arcane_charge(2), crimson_chorus(3)
2:29.752 aoe s arcane_explosion Fluffy_Pillow 13585.9/72624: 19% mana arcane_charge(3), crimson_chorus(3)
2:31.025 aoe t arcane_barrage Fluffy_Pillow 10346.9/72624: 14% mana arcane_charge(4), crimson_chorus(3)
2:32.299 aoe s arcane_explosion Fluffy_Pillow 15014.2/72624: 21% mana crimson_chorus(3)
2:33.570 aoe s arcane_explosion Fluffy_Pillow 11772.4/72624: 16% mana arcane_charge, crimson_chorus(3)
2:34.843 aoe n touch_of_the_magi Fluffy_Pillow 8533.3/72624: 12% mana arcane_charge(2)
2:36.116 aoe p rune_of_power Fluffy_Pillow 7794.3/72624: 11% mana arcane_charge(4), clearcasting
2:37.390 aoe r arcane_missiles Fluffy_Pillow 9556.6/72624: 13% mana arcane_charge(4), clearcasting, rune_of_power
2:39.379 aoe t arcane_barrage Fluffy_Pillow 12308.0/72624: 17% mana arcane_charge(4), rune_of_power
2:40.653 aoe q arcane_orb Fluffy_Pillow 16975.3/72624: 23% mana rune_of_power
2:41.927 aoe r arcane_missiles Fluffy_Pillow 18237.7/72624: 25% mana arcane_charge(4), clearcasting, rune_of_power
2:43.798 aoe t arcane_barrage Fluffy_Pillow 20825.9/72624: 29% mana arcane_charge(4), rune_of_power
2:45.071 aoe s arcane_explosion Fluffy_Pillow 25491.8/72624: 35% mana rune_of_power
2:46.344 aoe r arcane_missiles Fluffy_Pillow 22252.7/72624: 31% mana arcane_charge, clearcasting, rune_of_power
2:48.334 aoe s arcane_explosion Fluffy_Pillow 25005.5/72624: 34% mana arcane_charge, rune_of_power
2:49.607 aoe s arcane_explosion Fluffy_Pillow 21766.5/72624: 30% mana arcane_charge(2)
2:50.881 aoe r arcane_missiles Fluffy_Pillow 18528.8/72624: 26% mana arcane_charge(3), clearcasting
2:52.862 aoe s arcane_explosion Fluffy_Pillow 21269.2/72624: 29% mana arcane_charge(3)
2:54.137 aoe t arcane_barrage Fluffy_Pillow 18032.9/72624: 25% mana arcane_charge(4)
2:55.410 aoe s arcane_explosion Fluffy_Pillow 22698.8/72624: 31% mana
2:56.684 aoe s arcane_explosion Fluffy_Pillow 19461.2/72624: 27% mana arcane_charge
2:57.959 aoe s arcane_explosion Fluffy_Pillow 16224.9/72624: 22% mana arcane_charge(2)
2:59.232 aoe s arcane_explosion Fluffy_Pillow 12985.8/72624: 18% mana arcane_charge(3)
3:00.505 aoe t arcane_barrage Fluffy_Pillow 9746.8/72624: 13% mana arcane_charge(4)
3:01.778 aoe q arcane_orb Fluffy_Pillow 14412.7/72624: 20% mana
3:03.051 aoe t arcane_barrage Fluffy_Pillow 15673.7/72624: 22% mana arcane_charge(4)
3:04.326 aoe s arcane_explosion Fluffy_Pillow 20342.4/72624: 28% mana
3:05.600 aoe s arcane_explosion Fluffy_Pillow 17104.7/72624: 24% mana arcane_charge, crimson_chorus
3:06.873 aoe s arcane_explosion Fluffy_Pillow 13865.7/72624: 19% mana arcane_charge(2), crimson_chorus
3:08.147 aoe s arcane_explosion Fluffy_Pillow 10628.0/72624: 15% mana arcane_charge(3), crimson_chorus
3:09.420 aoe r arcane_missiles Fluffy_Pillow 7389.0/72624: 10% mana arcane_charge(4), clearcasting, crimson_chorus
3:11.182 aoe t arcane_barrage Fluffy_Pillow 9826.4/72624: 14% mana arcane_charge(4), crimson_chorus
3:12.455 aoe s arcane_explosion Fluffy_Pillow 14492.3/72624: 20% mana crimson_chorus
3:13.727 aoe s arcane_explosion Fluffy_Pillow 11251.9/72624: 15% mana arcane_charge, crimson_chorus
3:14.999 aoe s arcane_explosion Fluffy_Pillow 8011.4/72624: 11% mana arcane_charge(2), crimson_chorus(2)
3:16.275 aoe u evocation gnome 4776.6/72624: 7% mana arcane_charge(3), crimson_chorus(2)
3:20.508 aoe s arcane_explosion Fluffy_Pillow 63555.0/72624: 88% mana arcane_charge(3), crimson_chorus(2)
3:21.783 aoe t arcane_barrage Fluffy_Pillow 60318.7/72624: 83% mana arcane_charge(4), crimson_chorus(2)
3:23.057 aoe n touch_of_the_magi Fluffy_Pillow 64986.0/72624: 89% mana crimson_chorus(2)
3:24.329 aoe p rune_of_power Fluffy_Pillow 64245.6/72624: 88% mana arcane_charge(4), crimson_chorus(3)
3:25.603 aoe t arcane_barrage Fluffy_Pillow 66007.9/72624: 91% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:26.877 aoe q arcane_orb Fluffy_Pillow 70675.2/72624: 97% mana rune_of_power, crimson_chorus(3)
3:28.151 aoe t arcane_barrage Fluffy_Pillow 71937.6/72624: 99% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:29.424 aoe s arcane_explosion Fluffy_Pillow 72624.0/72624: 100% mana rune_of_power, crimson_chorus(3)
3:30.698 aoe s arcane_explosion Fluffy_Pillow 69386.3/72624: 96% mana arcane_charge, rune_of_power, crimson_chorus(3)
3:31.973 aoe s arcane_explosion Fluffy_Pillow 66150.1/72624: 91% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
3:33.246 aoe r arcane_missiles Fluffy_Pillow 62911.0/72624: 87% mana arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3)
3:35.219 aoe s arcane_explosion Fluffy_Pillow 65640.3/72624: 90% mana arcane_charge(3), rune_of_power
3:36.492 aoe t arcane_barrage Fluffy_Pillow 62401.3/72624: 86% mana arcane_charge(4), rune_of_power
3:37.767 aoe s arcane_explosion Fluffy_Pillow 67070.0/72624: 92% mana
3:39.044 aoe s arcane_explosion Fluffy_Pillow 63836.4/72624: 88% mana arcane_charge
3:40.318 aoe s arcane_explosion Fluffy_Pillow 60598.8/72624: 83% mana arcane_charge(2)
3:41.592 aoe s arcane_explosion Fluffy_Pillow 57361.1/72624: 79% mana arcane_charge(3)
3:42.865 aoe t arcane_barrage Fluffy_Pillow 54122.1/72624: 75% mana arcane_charge(4)
3:44.138 aoe s arcane_explosion Fluffy_Pillow 58788.0/72624: 81% mana
3:45.411 aoe s arcane_explosion Fluffy_Pillow 55549.0/72624: 76% mana arcane_charge
3:46.685 aoe r arcane_missiles Fluffy_Pillow 52311.3/72624: 72% mana arcane_charge(2), clearcasting
3:48.696 aoe s arcane_explosion Fluffy_Pillow 55093.2/72624: 76% mana arcane_charge(2)
3:49.971 aoe s arcane_explosion Fluffy_Pillow 51856.9/72624: 71% mana arcane_charge(3)
3:51.245 aoe t arcane_barrage Fluffy_Pillow 48619.2/72624: 67% mana arcane_charge(4)
3:52.519 aoe q arcane_orb Fluffy_Pillow 53286.5/72624: 73% mana
3:53.792 aoe t arcane_barrage Fluffy_Pillow 54547.5/72624: 75% mana arcane_charge(4)
3:55.066 aoe s arcane_explosion Fluffy_Pillow 59214.8/72624: 82% mana
3:56.339 aoe s arcane_explosion Fluffy_Pillow 55975.7/72624: 77% mana arcane_charge
3:57.612 aoe s arcane_explosion Fluffy_Pillow 52736.7/72624: 73% mana arcane_charge(2)
3:58.886 aoe s arcane_explosion Fluffy_Pillow 49499.0/72624: 68% mana arcane_charge(3)
4:00.160 aoe t arcane_barrage Fluffy_Pillow 46261.4/72624: 64% mana arcane_charge(4)
4:01.433 aoe s arcane_explosion Fluffy_Pillow 50927.3/72624: 70% mana
4:02.706 aoe s arcane_explosion Fluffy_Pillow 47688.3/72624: 66% mana arcane_charge
4:03.981 aoe s arcane_explosion Fluffy_Pillow 44452.0/72624: 61% mana arcane_charge(2)
4:05.254 aoe s arcane_explosion Fluffy_Pillow 41213.0/72624: 57% mana arcane_charge(3)
4:06.529 aoe t arcane_barrage Fluffy_Pillow 37976.7/72624: 52% mana arcane_charge(4), crimson_chorus
4:07.802 aoe s arcane_explosion Fluffy_Pillow 42642.6/72624: 59% mana crimson_chorus
4:09.075 aoe s arcane_explosion Fluffy_Pillow 39403.6/72624: 54% mana arcane_charge, crimson_chorus
4:10.349 aoe n touch_of_the_magi Fluffy_Pillow 36165.9/72624: 50% mana arcane_charge(2), crimson_chorus
4:11.623 aoe o arcane_power Fluffy_Pillow 35428.2/72624: 49% mana arcane_charge(4), crimson_chorus
4:11.623 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 35428.2/72624: 49% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
4:11.623 aoe t arcane_barrage Fluffy_Pillow 35428.2/72624: 49% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:12.895 aoe q arcane_orb Fluffy_Pillow 40092.8/72624: 55% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:14.169 aoe t arcane_barrage Fluffy_Pillow 41605.1/72624: 57% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:15.444 aoe s arcane_explosion Fluffy_Pillow 46273.8/72624: 64% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:16.717 aoe s arcane_explosion Fluffy_Pillow 45534.8/72624: 63% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.991 aoe s arcane_explosion Fluffy_Pillow 44797.1/72624: 62% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.264 aoe s arcane_explosion Fluffy_Pillow 44058.1/72624: 61% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.535 shared_cds w use_mana_gem gnome 43316.3/72624: 60% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.535 aoe t arcane_barrage Fluffy_Pillow 50578.7/72624: 70% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.809 aoe s arcane_explosion Fluffy_Pillow 55246.0/72624: 76% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:23.085 aoe s arcane_explosion Fluffy_Pillow 54511.1/72624: 75% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:24.358 aoe s arcane_explosion Fluffy_Pillow 53772.0/72624: 74% mana arcane_charge(2), arcane_power, crimson_chorus(2), gladiators_badge
4:25.632 aoe s arcane_explosion Fluffy_Pillow 53034.4/72624: 73% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:26.904 aoe p rune_of_power Fluffy_Pillow 52293.9/72624: 72% mana arcane_charge(4), crimson_chorus(3)
4:28.175 aoe t arcane_barrage Fluffy_Pillow 54052.1/72624: 74% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:29.448 aoe s arcane_explosion Fluffy_Pillow 58718.1/72624: 81% mana rune_of_power, crimson_chorus(3)
4:30.721 aoe s arcane_explosion Fluffy_Pillow 55479.0/72624: 76% mana arcane_charge, rune_of_power, crimson_chorus(3)
4:31.995 aoe s arcane_explosion Fluffy_Pillow 52241.4/72624: 72% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
4:33.268 aoe s arcane_explosion Fluffy_Pillow 49002.3/72624: 67% mana arcane_charge(3), rune_of_power, crimson_chorus(3)
4:34.542 aoe t arcane_barrage Fluffy_Pillow 45764.7/72624: 63% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:35.816 aoe q arcane_orb Fluffy_Pillow 50432.0/72624: 69% mana rune_of_power
4:37.090 aoe t arcane_barrage Fluffy_Pillow 51694.3/72624: 71% mana arcane_charge(4), rune_of_power
4:38.363 aoe s arcane_explosion Fluffy_Pillow 56360.2/72624: 78% mana rune_of_power
4:39.635 aoe s arcane_explosion Fluffy_Pillow 53119.8/72624: 73% mana arcane_charge, rune_of_power
4:40.910 aoe s arcane_explosion Fluffy_Pillow 49883.5/72624: 69% mana arcane_charge(2)
4:42.182 aoe s arcane_explosion Fluffy_Pillow 46643.1/72624: 64% mana arcane_charge(3)
4:43.457 aoe t arcane_barrage Fluffy_Pillow 43406.8/72624: 60% mana arcane_charge(4)
4:44.731 aoe s arcane_explosion Fluffy_Pillow 48074.1/72624: 66% mana
4:46.005 aoe s arcane_explosion Fluffy_Pillow 44836.5/72624: 62% mana arcane_charge
4:47.278 aoe s arcane_explosion Fluffy_Pillow 41597.4/72624: 57% mana arcane_charge(2)
4:48.551 aoe s arcane_explosion Fluffy_Pillow 38358.4/72624: 53% mana arcane_charge(3)
4:49.822 aoe r arcane_missiles Fluffy_Pillow 35116.6/72624: 48% mana arcane_charge(4), clearcasting
4:51.775 aoe t arcane_barrage Fluffy_Pillow 37818.2/72624: 52% mana arcane_charge(4)
4:53.047 aoe s arcane_explosion Fluffy_Pillow 42482.7/72624: 58% mana
4:54.322 aoe s arcane_explosion Fluffy_Pillow 39246.5/72624: 54% mana arcane_charge
4:55.594 aoe s arcane_explosion Fluffy_Pillow 36006.0/72624: 50% mana arcane_charge(2)
4:56.869 aoe s arcane_explosion Fluffy_Pillow 32769.8/72624: 45% mana arcane_charge(3)
4:58.143 aoe t arcane_barrage Fluffy_Pillow 29532.1/72624: 41% mana arcane_charge(4)
4:59.418 aoe q arcane_orb Fluffy_Pillow 34200.8/72624: 47% mana
5:00.692 aoe t arcane_barrage Fluffy_Pillow 35463.1/72624: 49% mana arcane_charge(4)
5:01.964 aoe s arcane_explosion Fluffy_Pillow 40127.7/72624: 55% mana

Stats

Level Bonus (60) Race Bonus (gnome) Raid-Buffed Unbuffed Gear Amount
Strength 198 -3 195 195 0
Agility 306 1 307 307 0
Stamina 414 -1 2026 1930 1517
Intellect 450 3 1799 1619 1089 (46)
Spirit 0 0 0 0 0
Health 40520 38600 0
Mana 72624 72624 0
Spell Power 1799 1619 0
Crit 14.34% 14.34% 327
Haste 18.17% 18.17% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="gnome"
source=default
spec=arcane
level=60
race=gnome
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

human : 8872 dps, 4542 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8872.1 8872.1 16.2 / 0.183% 1126.6 / 12.7% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2050.3 1944.8 Mana 0.00% 48.0 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
human 8872
Arcane Barrage 3731 42.1% 50.1 6.02sec 22407 18170 Direct 150.2 6311 13059 7481 17.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.13 150.17 0.00 0.00 1.2332 0.0000 1123157.12 1123157.12 0.00% 18169.95 18169.95
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.65% 124.12 89 160 6310.90 2179 30833 6302.41 5435 7295 783024 783024 0.00%
crit 17.35% 26.05 9 48 13058.93 4359 61667 13018.76 7965 21160 340133 340133 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.12
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 911 1822 1050 15.4%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1051.24 1051.24 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.62% 0.85 0 1 911.07 911 911 770.91 0 911 771 771 0.00%
crit 15.38% 0.15 0 1 1822.15 1822 1822 280.33 0 1822 280 280 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2931 33.0% 130.0 2.29sec 6777 5512 Direct 389.9 1909 3910 2259 17.5%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.96 389.87 0.00 0.00 1.2294 0.0000 880674.66 880674.66 0.00% 5511.97 5511.97
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.52% 321.72 237 412 1909.37 1459 3589 1909.65 1783 2026 614171 614171 0.00%
crit 17.48% 68.15 37 100 3910.43 2918 7178 3910.94 3384 4573 266504 266504 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.96
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1011 11.4% 24.5 11.69sec 12399 6544 Periodic 195.5 1318 2680 1554 17.3% 4.5%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.52 0.00 195.66 195.54 1.8948 0.2058 304043.43 304043.43 0.00% 6543.63 6543.63
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.66% 161.63 73 279 1318.19 1069 2631 1318.72 1131 1626 213115 213115 0.00%
crit 17.34% 33.92 8 64 2679.93 2138 5261 2678.69 2178 3535 90928 90928 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.53
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (596) 0.0% (6.7%) 12.7 24.33sec 14045 11362

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.75 0.00 0.00 0.00 1.2362 0.0000 0.00 0.00 0.00% 11361.57 11361.57

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.74
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 596 6.7% 38.2 24.33sec 4689 0 Direct 38.2 3971 8100 4692 17.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.17 38.17 0.00 0.00 0.0000 0.0000 179001.53 179001.53 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.56% 31.52 19 43 3970.86 2883 7093 3969.57 3118 4677 125100 125100 0.00%
crit 17.44% 6.66 0 15 8100.21 5766 14186 8084.21 0 12056 53901 53901 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 14.0 1.81sec 514 0 Periodic 40.4 (42.4) 113 0 113 0.0% (0.0%) 4.4%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.98 0.00 40.41 40.41 0.0000 0.9864 4560.06 4560.06 0.00% 180.22 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.41 15 64 112.85 0 202 112.86 70 168 4560 4560 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 2.0 9.69sec 1343 0 Direct 2.0 1115 2229 1342 20.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.95 1.95 0.00 0.00 0.0000 0.0000 2623.14 2623.14 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.48% 1.55 0 3 1114.72 1094 1160 1046.15 0 1160 1730 1730 0.00%
crit 20.52% 0.40 0 3 2229.49 2188 2319 805.61 0 2319 893 893 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.3 14.22sec 533 0 Direct 20.3 453 905 533 17.7%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.33 20.33 0.00 0.00 0.0000 0.0000 10832.03 10832.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.30% 16.73 6 31 452.65 444 471 452.67 444 464 7573 7573 0.00%
crit 17.70% 3.60 0 11 905.48 889 942 883.19 0 942 3259 3259 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4111 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 103  / 14 0.2% 90.0 1.31sec 46 34 Direct 90.0 38 78 46 18.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3241 0.0000 4111.07 4111.07 0.00% 34.50 34.50
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.25% 73.12 60 83 38.27 30 46 38.27 37 40 2799 2799 0.00%
crit 18.75% 16.88 7 30 77.75 59 92 77.77 66 88 1313 1313 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (525) 0.0% (5.9%) 6.2 51.96sec 25392 19800

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.2825 0.0000 0.00 0.00 0.00% 19799.50 19799.50

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.24
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 525 5.9% 6.2 51.86sec 25392 0 Direct 18.6 8504 0 8504 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.57 0.00 0.00 0.0000 0.0000 157782.23 157782.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.57 15 21 8503.65 716 39633 8488.83 5562 12077 157782 157782 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6335.30
  • base_dd_max:6335.30
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
human
Arcane Power 2.9 127.20sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.48 0.00 2.85 0.00 4.1635 0.7071 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:human
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.48
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:human
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:human
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.27sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2338 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.09
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 122.75sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:human
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.9 137.2 5.9sec 1.6sec 4.6sec 78.07% 0.00% 3.0 (4.2) 0.0

Buff Details

  • buff initial source:human
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 17.8s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.3s

Stack Uptimes

  • arcane_charge_1:20.58%
  • arcane_charge_2:17.81%
  • arcane_charge_3:16.94%
  • arcane_charge_4:22.73%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.2sec 127.2sec 14.7sec 14.04% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:human
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 138.4s
  • trigger_min/max:120.0s / 138.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.04%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:human
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.7 0.0 11.8sec 11.8sec 1.3sec 10.53% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:human
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.52%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.05% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:human
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 67.0s
  • trigger_min/max:60.0s / 67.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.95%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 0.0sec 0.0sec 4.2sec 0.67% 0.00% 1.9 (1.9) 0.0

Buff Details

  • buff initial source:human
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 4.3s

Stack Uptimes

  • evocation_1:0.67%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 4.0 0.0 86.0sec 86.0sec 14.6sec 19.12% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:human
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 138.4s
  • trigger_min/max:60.0s / 138.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.12%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:human
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.9sec 34.9sec 11.8sec 35.04% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:human
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.0s / 60.7s
  • trigger_min/max:12.0s / 60.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.04%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:human
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:human
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:human
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.90% 0.77% 5.13% 0.9s 0.0s 4.5s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation221.89684.122357.595269.450155.321359.985
Rune of Power6.0480.00033.07938.20816.80274.873
Touch of the Magi4.7520.00049.39131.21615.22571.101
Arcane Power5.1410.00018.44514.9762.53927.405
Arcane Barrage3.5180.00313.993178.003138.387220.745
Arcane Orb4.1930.00016.58354.07429.62688.047

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
human
mana_regen Mana 1050.47 407844.85 69.74% 388.25 9402.41 2.25%
Evocation Mana 22.19 25057.55 4.28% 1129.02 0.00 0.00%
Mana Gem Mana 2.75 19109.90 3.27% 6945.71 0.00 0.00%
Arcane Barrage Mana 50.12 132831.80 22.71% 2650.23 6418.13 4.61%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 68082.1 1944.76 2050.30 15832.8 37711.6 496.0 69457.1
Usage Type Count Total Avg RPE APR
human
arcane_explosion Mana 130.0 593939.6 4570.3 4570.3 1.5
arcane_orb Mana 12.7 5803.8 455.4 455.4 30.8
touch_of_the_magi Mana 6.2 15522.5 2499.3 2498.1 10.2

Statistics & Data Analysis

Fight Length
human Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
human Damage Per Second
Count 1118
Mean 8872.12
Minimum 8050.40
Maximum 10014.43
Spread ( max - min ) 1964.02
Range [ ( max - min ) / 2 * 100% ] 11.07%
Standard Deviation 277.0038
5th Percentile 8434.77
95th Percentile 9339.76
( 95th Percentile - 5th Percentile ) 904.99
Mean Distribution
Standard Deviation 8.2845
95.00% Confidence Interval ( 8855.88 - 8888.36 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3745
0.1 Scale Factor Error with Delta=300 656
0.05 Scale Factor Error with Delta=300 2621
0.01 Scale Factor Error with Delta=300 65503
Priority Target DPS
human Priority Target Damage Per Second
Count 1118
Mean 4541.86
Minimum 3936.06
Maximum 5372.67
Spread ( max - min ) 1436.60
Range [ ( max - min ) / 2 * 100% ] 15.82%
Standard Deviation 196.9808
5th Percentile 4233.86
95th Percentile 4861.62
( 95th Percentile - 5th Percentile ) 627.75
Mean Distribution
Standard Deviation 5.8912
95.00% Confidence Interval ( 4530.32 - 4553.41 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7226
0.1 Scale Factor Error with Delta=300 332
0.05 Scale Factor Error with Delta=300 1325
0.01 Scale Factor Error with Delta=300 33124
DPS(e)
human Damage Per Second (Effective)
Count 1118
Mean 8872.12
Minimum 8050.40
Maximum 10014.43
Spread ( max - min ) 1964.02
Range [ ( max - min ) / 2 * 100% ] 11.07%
Damage
human Damage
Count 1118
Mean 2663725.44
Minimum 1998937.02
Maximum 3290484.84
Spread ( max - min ) 1291547.82
Range [ ( max - min ) / 2 * 100% ] 24.24%
DTPS
human Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
human Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
human Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
human Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
human Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
human Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
humanTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
human Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.24 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.09 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.74 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.53 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.96 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.12 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.48 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.95 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxtqtssrsstsrsssptsssvstqtssssrtsrssstsssrstqtssrsstssrnxprtqtssrsrstssrsrstqtssrssrtsssstnptqtssrssroxtsssstsssrstqtsrsssvtsssstnptqtsssstsssrsrtsrsssrtqtsrssstssnptsssstqtssrsstsssstsssrstqtsrssstnoxtsssstqtssssptvssssrtssssrtqtsssrstsss

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat T flask human 69457.1/69457: 100% mana
Pre precombat U food human 69457.1/69457: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69457.1/69457: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69457.1/69457: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 68082.1/69457: 98% mana
0:01.283 aoe o arcane_power Fluffy_Pillow 66964.1/69457: 96% mana bloodlust, crimson_chorus
0:01.283 shared_cds w potion Fluffy_Pillow 66964.1/69457: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:01.283 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66964.1/69457: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.283 aoe t arcane_barrage Fluffy_Pillow 66964.1/69457: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.271 aoe q arcane_orb Fluffy_Pillow 69457.1/69457: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.258 aoe t arcane_barrage Fluffy_Pillow 69457.1/69457: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.244 aoe s arcane_explosion Fluffy_Pillow 69457.1/69457: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.231 aoe s arcane_explosion Fluffy_Pillow 68328.2/69457: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.219 aoe r arcane_missiles Fluffy_Pillow 67200.7/69457: 97% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.733 aoe s arcane_explosion Fluffy_Pillow 69303.9/69457: 100% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.719 aoe s arcane_explosion Fluffy_Pillow 68173.6/69457: 98% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.709 aoe t arcane_barrage Fluffy_Pillow 67048.8/69457: 97% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.697 aoe s arcane_explosion Fluffy_Pillow 69457.1/69457: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.685 aoe r arcane_missiles Fluffy_Pillow 68329.6/69457: 98% mana bloodlust, arcane_charge, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.320 aoe s arcane_explosion Fluffy_Pillow 69457.1/69457: 100% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.309 aoe s arcane_explosion Fluffy_Pillow 68331.0/69457: 98% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.296 aoe s arcane_explosion Fluffy_Pillow 67202.1/69457: 97% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.284 aoe p rune_of_power Fluffy_Pillow 66074.6/69457: 95% mana bloodlust, arcane_charge(4), crimson_chorus(2), potion_of_deathly_fixation
0:17.273 aoe t arcane_barrage Fluffy_Pillow 67448.4/69457: 97% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:18.261 aoe s arcane_explosion Fluffy_Pillow 69457.1/69457: 100% mana bloodlust, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.249 aoe s arcane_explosion Fluffy_Pillow 65829.6/69457: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.236 aoe s arcane_explosion Fluffy_Pillow 62200.7/69457: 90% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.223 shared_cds v use_mana_gem human 58571.8/69457: 84% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.223 aoe s arcane_explosion Fluffy_Pillow 65517.5/69457: 94% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.212 aoe t arcane_barrage Fluffy_Pillow 61891.4/69457: 89% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.201 aoe q arcane_orb Fluffy_Pillow 66043.5/69457: 95% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.189 aoe t arcane_barrage Fluffy_Pillow 66916.0/69457: 96% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.175 aoe s arcane_explosion Fluffy_Pillow 69457.1/69457: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.163 aoe s arcane_explosion Fluffy_Pillow 65829.6/69457: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.152 aoe s arcane_explosion Fluffy_Pillow 62203.5/69457: 90% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3)
0:28.142 aoe s arcane_explosion Fluffy_Pillow 58578.7/69457: 84% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3)
0:29.132 aoe r arcane_missiles Fluffy_Pillow 54954.0/69457: 79% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3)
0:30.769 aoe t arcane_barrage Fluffy_Pillow 57228.0/69457: 82% mana bloodlust, arcane_charge(4)
0:31.756 aoe s arcane_explosion Fluffy_Pillow 61377.4/69457: 88% mana bloodlust
0:32.745 aoe r arcane_missiles Fluffy_Pillow 57751.2/69457: 83% mana bloodlust, arcane_charge, clearcasting
0:34.319 aoe s arcane_explosion Fluffy_Pillow 59937.8/69457: 86% mana bloodlust, arcane_charge
0:35.308 aoe s arcane_explosion Fluffy_Pillow 56311.6/69457: 81% mana bloodlust, arcane_charge(2)
0:36.294 aoe s arcane_explosion Fluffy_Pillow 52681.3/69457: 76% mana bloodlust, arcane_charge(3)
0:37.281 aoe t arcane_barrage Fluffy_Pillow 49052.4/69457: 71% mana bloodlust, arcane_charge(4)
0:38.267 aoe s arcane_explosion Fluffy_Pillow 53200.4/69457: 77% mana bloodlust
0:39.254 aoe s arcane_explosion Fluffy_Pillow 49571.5/69457: 71% mana bloodlust, arcane_charge
0:40.240 aoe s arcane_explosion Fluffy_Pillow 45941.2/69457: 66% mana bloodlust, arcane_charge(2)
0:41.227 aoe r arcane_missiles Fluffy_Pillow 42312.2/69457: 61% mana arcane_charge(3), clearcasting
0:43.152 aoe s arcane_explosion Fluffy_Pillow 44986.3/69457: 65% mana arcane_charge(3)
0:44.434 aoe t arcane_barrage Fluffy_Pillow 41767.2/69457: 60% mana arcane_charge(4)
0:45.718 aoe q arcane_orb Fluffy_Pillow 46329.2/69457: 67% mana
0:47.000 aoe t arcane_barrage Fluffy_Pillow 47610.0/69457: 69% mana arcane_charge(4)
0:48.283 aoe s arcane_explosion Fluffy_Pillow 52170.6/69457: 75% mana
0:49.565 aoe s arcane_explosion Fluffy_Pillow 48951.5/69457: 70% mana arcane_charge
0:50.846 aoe r arcane_missiles Fluffy_Pillow 45731.0/69457: 66% mana arcane_charge(2), clearcasting
0:52.737 aoe s arcane_explosion Fluffy_Pillow 48357.8/69457: 70% mana arcane_charge(2)
0:54.021 aoe s arcane_explosion Fluffy_Pillow 45141.5/69457: 65% mana arcane_charge(3)
0:55.302 aoe t arcane_barrage Fluffy_Pillow 41921.0/69457: 60% mana arcane_charge(4)
0:56.585 aoe s arcane_explosion Fluffy_Pillow 46481.5/69457: 67% mana
0:57.867 aoe s arcane_explosion Fluffy_Pillow 43262.4/69457: 62% mana arcane_charge
0:59.151 aoe r arcane_missiles Fluffy_Pillow 40046.1/69457: 58% mana arcane_charge(2), clearcasting
1:01.091 aoe n touch_of_the_magi Fluffy_Pillow 42741.0/69457: 62% mana arcane_charge(2), crimson_chorus
1:02.374 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 42023.3/69457: 61% mana arcane_charge(4), clearcasting, crimson_chorus
1:02.374 aoe p rune_of_power Fluffy_Pillow 42023.3/69457: 61% mana arcane_charge(4), clearcasting, crimson_chorus, gladiators_badge
1:03.657 aoe r arcane_missiles Fluffy_Pillow 43805.6/69457: 63% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus, gladiators_badge
1:05.591 aoe t arcane_barrage Fluffy_Pillow 46492.2/69457: 67% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:06.876 aoe q arcane_orb Fluffy_Pillow 51055.5/69457: 74% mana rune_of_power, crimson_chorus, gladiators_badge
1:08.157 aoe t arcane_barrage Fluffy_Pillow 52335.0/69457: 75% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:09.440 aoe s arcane_explosion Fluffy_Pillow 56895.6/69457: 82% mana rune_of_power, crimson_chorus, gladiators_badge
1:10.722 aoe s arcane_explosion Fluffy_Pillow 53676.4/69457: 77% mana arcane_charge, rune_of_power, crimson_chorus(2), gladiators_badge
1:12.004 aoe r arcane_missiles Fluffy_Pillow 50457.3/69457: 73% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
1:14.062 aoe s arcane_explosion Fluffy_Pillow 53316.2/69457: 77% mana arcane_charge(2), rune_of_power, crimson_chorus(2), gladiators_badge
1:15.345 aoe r arcane_missiles Fluffy_Pillow 50098.4/69457: 72% mana arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
1:17.323 aoe s arcane_explosion Fluffy_Pillow 52846.2/69457: 76% mana arcane_charge(3), crimson_chorus(2), gladiators_badge
1:18.606 aoe t arcane_barrage Fluffy_Pillow 49628.4/69457: 71% mana arcane_charge(4), crimson_chorus(2)
1:19.889 aoe s arcane_explosion Fluffy_Pillow 54189.0/69457: 78% mana crimson_chorus(2)
1:21.171 aoe s arcane_explosion Fluffy_Pillow 50969.9/69457: 73% mana arcane_charge, crimson_chorus(3)
1:22.453 aoe r arcane_missiles Fluffy_Pillow 47750.8/69457: 69% mana arcane_charge(2), clearcasting, crimson_chorus(3)
1:24.503 aoe s arcane_explosion Fluffy_Pillow 50598.5/69457: 73% mana arcane_charge(2), crimson_chorus(3)
1:25.786 aoe r arcane_missiles Fluffy_Pillow 47380.8/69457: 68% mana arcane_charge(3), clearcasting, crimson_chorus(3)
1:27.755 aoe s arcane_explosion Fluffy_Pillow 50116.0/69457: 72% mana arcane_charge(3), crimson_chorus(3)
1:29.037 aoe t arcane_barrage Fluffy_Pillow 46896.9/69457: 68% mana arcane_charge(4), crimson_chorus(3)
1:30.319 aoe q arcane_orb Fluffy_Pillow 51456.0/69457: 74% mana
1:31.602 aoe t arcane_barrage Fluffy_Pillow 52738.3/69457: 76% mana arcane_charge(4)
1:32.886 aoe s arcane_explosion Fluffy_Pillow 57300.3/69457: 82% mana
1:34.169 aoe s arcane_explosion Fluffy_Pillow 54082.5/69457: 78% mana arcane_charge
1:35.451 aoe r arcane_missiles Fluffy_Pillow 50863.4/69457: 73% mana arcane_charge(2), clearcasting
1:37.438 aoe s arcane_explosion Fluffy_Pillow 53623.6/69457: 77% mana arcane_charge(2)
1:38.720 aoe s arcane_explosion Fluffy_Pillow 50404.5/69457: 73% mana arcane_charge(3)
1:40.002 aoe r arcane_missiles Fluffy_Pillow 47185.4/69457: 68% mana arcane_charge(4), clearcasting
1:42.066 aoe t arcane_barrage Fluffy_Pillow 50052.6/69457: 72% mana arcane_charge(4)
1:43.350 aoe s arcane_explosion Fluffy_Pillow 54614.5/69457: 79% mana
1:44.631 aoe s arcane_explosion Fluffy_Pillow 51394.0/69457: 74% mana arcane_charge
1:45.913 aoe s arcane_explosion Fluffy_Pillow 48174.9/69457: 69% mana arcane_charge(2)
1:47.196 aoe s arcane_explosion Fluffy_Pillow 44957.2/69457: 65% mana arcane_charge(3)
1:48.478 aoe t arcane_barrage Fluffy_Pillow 41738.1/69457: 60% mana arcane_charge(4)
1:49.760 aoe n touch_of_the_magi Fluffy_Pillow 46297.2/69457: 67% mana
1:51.042 aoe p rune_of_power Fluffy_Pillow 45578.1/69457: 66% mana arcane_charge(4)
1:52.324 aoe t arcane_barrage Fluffy_Pillow 47359.0/69457: 68% mana arcane_charge(4), rune_of_power
1:53.606 aoe q arcane_orb Fluffy_Pillow 51918.1/69457: 75% mana rune_of_power
1:54.889 aoe t arcane_barrage Fluffy_Pillow 53200.4/69457: 77% mana arcane_charge(4), rune_of_power
1:56.172 aoe s arcane_explosion Fluffy_Pillow 57761.0/69457: 83% mana rune_of_power
1:57.455 aoe s arcane_explosion Fluffy_Pillow 54543.2/69457: 79% mana arcane_charge, rune_of_power
1:58.738 aoe r arcane_missiles Fluffy_Pillow 51325.5/69457: 74% mana arcane_charge(2), clearcasting, rune_of_power
2:00.599 aoe s arcane_explosion Fluffy_Pillow 53910.7/69457: 78% mana arcane_charge(2), rune_of_power, crimson_chorus
2:01.883 aoe s arcane_explosion Fluffy_Pillow 50694.4/69457: 73% mana arcane_charge(3), rune_of_power, crimson_chorus
2:03.166 aoe r arcane_missiles Fluffy_Pillow 47476.6/69457: 68% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
2:05.153 aoe o arcane_power Fluffy_Pillow 50236.9/69457: 72% mana arcane_charge(4), crimson_chorus
2:05.153 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 50236.9/69457: 72% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:05.153 aoe t arcane_barrage Fluffy_Pillow 50236.9/69457: 72% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:06.436 aoe s arcane_explosion Fluffy_Pillow 54797.4/69457: 79% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:07.719 aoe s arcane_explosion Fluffy_Pillow 54079.7/69457: 78% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:09.000 aoe s arcane_explosion Fluffy_Pillow 53359.2/69457: 77% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.284 aoe s arcane_explosion Fluffy_Pillow 52642.8/69457: 76% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:11.565 aoe t arcane_barrage Fluffy_Pillow 51922.3/69457: 75% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:12.847 aoe s arcane_explosion Fluffy_Pillow 56481.5/69457: 81% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.129 aoe s arcane_explosion Fluffy_Pillow 55762.4/69457: 80% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.414 aoe s arcane_explosion Fluffy_Pillow 55047.4/69457: 79% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.697 aoe r arcane_missiles Fluffy_Pillow 54329.7/69457: 78% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.588 aoe s arcane_explosion Fluffy_Pillow 56956.6/69457: 82% mana arcane_charge(3), arcane_power, crimson_chorus(2), gladiators_badge
2:19.871 aoe t arcane_barrage Fluffy_Pillow 56238.8/69457: 81% mana arcane_charge(4), arcane_power, crimson_chorus(2), gladiators_badge
2:21.153 aoe q arcane_orb Fluffy_Pillow 60798.0/69457: 88% mana crimson_chorus(3)
2:22.436 aoe t arcane_barrage Fluffy_Pillow 62080.3/69457: 89% mana arcane_charge(4), crimson_chorus(3)
2:23.719 aoe s arcane_explosion Fluffy_Pillow 66640.8/69457: 96% mana crimson_chorus(3)
2:25.002 aoe r arcane_missiles Fluffy_Pillow 63423.1/69457: 91% mana arcane_charge, clearcasting, crimson_chorus(3)
2:26.908 aoe s arcane_explosion Fluffy_Pillow 66070.8/69457: 95% mana arcane_charge, crimson_chorus(3)
2:28.192 aoe s arcane_explosion Fluffy_Pillow 62854.5/69457: 90% mana arcane_charge(2), crimson_chorus(3)
2:29.473 aoe s arcane_explosion Fluffy_Pillow 59634.0/69457: 86% mana arcane_charge(3), crimson_chorus(3)
2:30.754 shared_cds v use_mana_gem human 56413.5/69457: 81% mana arcane_charge(4)
2:30.754 aoe t arcane_barrage Fluffy_Pillow 63359.2/69457: 91% mana arcane_charge(4)
2:32.036 aoe s arcane_explosion Fluffy_Pillow 67918.3/69457: 98% mana
2:33.318 aoe s arcane_explosion Fluffy_Pillow 64699.2/69457: 93% mana arcane_charge
2:34.600 aoe s arcane_explosion Fluffy_Pillow 61480.1/69457: 89% mana arcane_charge(2)
2:35.885 aoe s arcane_explosion Fluffy_Pillow 58265.1/69457: 84% mana arcane_charge(3)
2:37.169 aoe t arcane_barrage Fluffy_Pillow 55048.8/69457: 79% mana arcane_charge(4)
2:38.452 aoe n touch_of_the_magi Fluffy_Pillow 59609.4/69457: 86% mana
2:39.735 aoe p rune_of_power Fluffy_Pillow 58891.6/69457: 85% mana arcane_charge(4)
2:41.017 aoe t arcane_barrage Fluffy_Pillow 60672.5/69457: 87% mana arcane_charge(4), rune_of_power
2:42.300 aoe q arcane_orb Fluffy_Pillow 65233.1/69457: 94% mana rune_of_power
2:43.583 aoe t arcane_barrage Fluffy_Pillow 66515.3/69457: 96% mana arcane_charge(4), rune_of_power
2:44.865 aoe s arcane_explosion Fluffy_Pillow 69457.1/69457: 100% mana rune_of_power
2:46.148 aoe s arcane_explosion Fluffy_Pillow 66239.4/69457: 95% mana arcane_charge, rune_of_power
2:47.431 aoe s arcane_explosion Fluffy_Pillow 63021.7/69457: 91% mana arcane_charge(2), rune_of_power
2:48.712 aoe s arcane_explosion Fluffy_Pillow 59801.2/69457: 86% mana arcane_charge(3), rune_of_power
2:49.996 aoe t arcane_barrage Fluffy_Pillow 56584.8/69457: 81% mana arcane_charge(4), rune_of_power
2:51.278 aoe s arcane_explosion Fluffy_Pillow 61144.0/69457: 88% mana rune_of_power
2:52.562 aoe s arcane_explosion Fluffy_Pillow 57927.7/69457: 83% mana arcane_charge, rune_of_power
2:53.844 aoe s arcane_explosion Fluffy_Pillow 54708.5/69457: 79% mana arcane_charge(2)
2:55.127 aoe r arcane_missiles Fluffy_Pillow 51490.8/69457: 74% mana arcane_charge(3), clearcasting
2:57.044 aoe s arcane_explosion Fluffy_Pillow 54153.8/69457: 78% mana arcane_charge(3)
2:58.325 aoe r arcane_missiles Fluffy_Pillow 50933.3/69457: 73% mana arcane_charge(4), clearcasting
3:00.381 aoe t arcane_barrage Fluffy_Pillow 53789.4/69457: 77% mana arcane_charge(4), crimson_chorus
3:01.662 aoe s arcane_explosion Fluffy_Pillow 58347.1/69457: 84% mana crimson_chorus
3:02.945 aoe r arcane_missiles Fluffy_Pillow 55129.4/69457: 79% mana arcane_charge, clearcasting, crimson_chorus
3:04.891 aoe s arcane_explosion Fluffy_Pillow 57832.7/69457: 83% mana arcane_charge, crimson_chorus
3:06.173 aoe s arcane_explosion Fluffy_Pillow 54613.6/69457: 79% mana arcane_charge(2), crimson_chorus
3:07.457 aoe s arcane_explosion Fluffy_Pillow 51397.2/69457: 74% mana arcane_charge(3), crimson_chorus
3:08.739 aoe r arcane_missiles Fluffy_Pillow 48178.1/69457: 69% mana arcane_charge(4), clearcasting, crimson_chorus
3:10.699 aoe t arcane_barrage Fluffy_Pillow 50900.8/69457: 73% mana arcane_charge(4), crimson_chorus(2)
3:11.983 aoe q arcane_orb Fluffy_Pillow 55462.8/69457: 80% mana crimson_chorus(2)
3:13.265 aoe t arcane_barrage Fluffy_Pillow 56743.7/69457: 82% mana arcane_charge(4), crimson_chorus(2)
3:14.547 aoe s arcane_explosion Fluffy_Pillow 61302.8/69457: 88% mana crimson_chorus(2)
3:15.829 aoe r arcane_missiles Fluffy_Pillow 58083.7/69457: 84% mana arcane_charge, clearcasting, crimson_chorus(2)
3:17.774 aoe s arcane_explosion Fluffy_Pillow 60785.6/69457: 88% mana arcane_charge, crimson_chorus(2)
3:19.057 aoe s arcane_explosion Fluffy_Pillow 57567.9/69457: 83% mana arcane_charge(2), crimson_chorus(2)
3:20.340 aoe s arcane_explosion Fluffy_Pillow 54350.1/69457: 78% mana arcane_charge(3), crimson_chorus(3)
3:21.623 aoe t arcane_barrage Fluffy_Pillow 51132.4/69457: 74% mana arcane_charge(4), crimson_chorus(3)
3:22.908 aoe s arcane_explosion Fluffy_Pillow 55695.7/69457: 80% mana crimson_chorus(3)
3:24.190 aoe s arcane_explosion Fluffy_Pillow 52476.6/69457: 76% mana arcane_charge, crimson_chorus(3)
3:25.472 aoe n touch_of_the_magi Fluffy_Pillow 49257.5/69457: 71% mana arcane_charge(2), crimson_chorus(3)
3:26.756 aoe p rune_of_power Fluffy_Pillow 48541.2/69457: 70% mana arcane_charge(4), crimson_chorus(3)
3:28.038 aoe t arcane_barrage Fluffy_Pillow 50322.0/69457: 72% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:29.321 aoe s arcane_explosion Fluffy_Pillow 54882.6/69457: 79% mana rune_of_power, crimson_chorus(3)
3:30.605 aoe s arcane_explosion Fluffy_Pillow 51666.3/69457: 74% mana arcane_charge, rune_of_power
3:31.887 aoe s arcane_explosion Fluffy_Pillow 48447.1/69457: 70% mana arcane_charge(2), rune_of_power
3:33.170 aoe s arcane_explosion Fluffy_Pillow 45229.4/69457: 65% mana arcane_charge(3), rune_of_power
3:34.455 aoe t arcane_barrage Fluffy_Pillow 42014.5/69457: 60% mana arcane_charge(4), rune_of_power
3:35.737 aoe q arcane_orb Fluffy_Pillow 46573.6/69457: 67% mana rune_of_power
3:37.020 aoe t arcane_barrage Fluffy_Pillow 47855.9/69457: 69% mana arcane_charge(4), rune_of_power
3:38.303 aoe s arcane_explosion Fluffy_Pillow 52416.4/69457: 75% mana rune_of_power
3:39.586 aoe s arcane_explosion Fluffy_Pillow 49198.7/69457: 71% mana arcane_charge, rune_of_power
3:40.869 aoe r arcane_missiles Fluffy_Pillow 45981.0/69457: 66% mana arcane_charge(2), clearcasting
3:42.833 aoe s arcane_explosion Fluffy_Pillow 48709.3/69457: 70% mana arcane_charge(2)
3:44.113 aoe s arcane_explosion Fluffy_Pillow 45487.4/69457: 65% mana arcane_charge(3)
3:45.395 aoe t arcane_barrage Fluffy_Pillow 42268.2/69457: 61% mana arcane_charge(4)
3:46.677 aoe s arcane_explosion Fluffy_Pillow 46827.4/69457: 67% mana
3:47.957 aoe s arcane_explosion Fluffy_Pillow 43605.5/69457: 63% mana arcane_charge
3:49.239 aoe s arcane_explosion Fluffy_Pillow 40386.4/69457: 58% mana arcane_charge(2)
3:50.521 aoe s arcane_explosion Fluffy_Pillow 37167.3/69457: 54% mana arcane_charge(3)
3:51.803 aoe t arcane_barrage Fluffy_Pillow 33948.2/69457: 49% mana arcane_charge(4)
3:53.084 aoe s arcane_explosion Fluffy_Pillow 38505.9/69457: 55% mana
3:54.366 aoe s arcane_explosion Fluffy_Pillow 35286.8/69457: 51% mana arcane_charge
3:55.648 aoe s arcane_explosion Fluffy_Pillow 32067.7/69457: 46% mana arcane_charge(2)
3:56.930 aoe r arcane_missiles Fluffy_Pillow 28848.6/69457: 42% mana arcane_charge(3), clearcasting
3:58.750 aoe s arcane_explosion Fluffy_Pillow 31376.8/69457: 45% mana arcane_charge(3)
4:00.032 aoe t arcane_barrage Fluffy_Pillow 28157.7/69457: 41% mana arcane_charge(4)
4:01.314 aoe q arcane_orb Fluffy_Pillow 32716.9/69457: 47% mana crimson_chorus
4:02.597 aoe t arcane_barrage Fluffy_Pillow 33999.1/69457: 49% mana arcane_charge(4), crimson_chorus
4:03.880 aoe s arcane_explosion Fluffy_Pillow 38559.7/69457: 56% mana crimson_chorus
4:05.162 aoe r arcane_missiles Fluffy_Pillow 35340.6/69457: 51% mana arcane_charge, clearcasting, crimson_chorus
4:07.126 aoe s arcane_explosion Fluffy_Pillow 38068.9/69457: 55% mana arcane_charge, crimson_chorus
4:08.408 aoe s arcane_explosion Fluffy_Pillow 34849.7/69457: 50% mana arcane_charge(2), crimson_chorus
4:09.692 aoe s arcane_explosion Fluffy_Pillow 31633.4/69457: 46% mana arcane_charge(3), crimson_chorus
4:10.974 aoe t arcane_barrage Fluffy_Pillow 28414.3/69457: 41% mana arcane_charge(4), crimson_chorus(2)
4:12.256 aoe n touch_of_the_magi Fluffy_Pillow 32973.4/69457: 47% mana crimson_chorus(2)
4:13.540 aoe o arcane_power Fluffy_Pillow 32257.1/69457: 46% mana arcane_charge(4), crimson_chorus(2)
4:13.540 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 32257.1/69457: 46% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:13.540 aoe t arcane_barrage Fluffy_Pillow 32257.1/69457: 46% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:14.821 aoe s arcane_explosion Fluffy_Pillow 36814.9/69457: 53% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:16.103 aoe s arcane_explosion Fluffy_Pillow 36095.8/69457: 52% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.386 aoe s arcane_explosion Fluffy_Pillow 35378.0/69457: 51% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.669 aoe s arcane_explosion Fluffy_Pillow 34660.3/69457: 50% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.950 aoe t arcane_barrage Fluffy_Pillow 33939.8/69457: 49% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.231 aoe q arcane_orb Fluffy_Pillow 38497.6/69457: 55% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:22.599 aoe t arcane_barrage Fluffy_Pillow 40147.9/69457: 58% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:23.881 aoe s arcane_explosion Fluffy_Pillow 44707.1/69457: 64% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.164 aoe s arcane_explosion Fluffy_Pillow 43989.4/69457: 63% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.447 aoe s arcane_explosion Fluffy_Pillow 43271.6/69457: 62% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
4:27.730 aoe s arcane_explosion Fluffy_Pillow 42553.9/69457: 61% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:29.013 aoe p rune_of_power Fluffy_Pillow 41836.2/69457: 60% mana arcane_charge(4), crimson_chorus(3)
4:30.296 aoe t arcane_barrage Fluffy_Pillow 43618.4/69457: 63% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:31.578 shared_cds v use_mana_gem human 48177.6/69457: 69% mana rune_of_power
4:31.578 aoe s arcane_explosion Fluffy_Pillow 55123.3/69457: 79% mana rune_of_power
4:32.861 aoe s arcane_explosion Fluffy_Pillow 51905.6/69457: 75% mana arcane_charge, rune_of_power
4:34.143 aoe s arcane_explosion Fluffy_Pillow 48686.5/69457: 70% mana arcane_charge(2), rune_of_power
4:35.426 aoe s arcane_explosion Fluffy_Pillow 45468.7/69457: 65% mana arcane_charge(3), rune_of_power
4:36.708 aoe r arcane_missiles Fluffy_Pillow 42249.6/69457: 61% mana arcane_charge(4), clearcasting, rune_of_power
4:38.747 aoe t arcane_barrage Fluffy_Pillow 45082.1/69457: 65% mana arcane_charge(4), rune_of_power
4:40.030 aoe s arcane_explosion Fluffy_Pillow 49642.6/69457: 71% mana rune_of_power
4:41.312 aoe s arcane_explosion Fluffy_Pillow 46423.5/69457: 67% mana arcane_charge, rune_of_power
4:42.594 aoe s arcane_explosion Fluffy_Pillow 43204.4/69457: 62% mana arcane_charge(2)
4:43.877 aoe s arcane_explosion Fluffy_Pillow 39986.7/69457: 58% mana arcane_charge(3)
4:45.159 aoe r arcane_missiles Fluffy_Pillow 36767.6/69457: 53% mana arcane_charge(4), clearcasting
4:47.146 aoe t arcane_barrage Fluffy_Pillow 39527.8/69457: 57% mana arcane_charge(4)
4:48.428 aoe q arcane_orb Fluffy_Pillow 44086.9/69457: 63% mana
4:49.710 aoe t arcane_barrage Fluffy_Pillow 45367.8/69457: 65% mana arcane_charge(4)
4:50.993 aoe s arcane_explosion Fluffy_Pillow 49928.4/69457: 72% mana
4:52.275 aoe s arcane_explosion Fluffy_Pillow 46709.3/69457: 67% mana arcane_charge
4:53.558 aoe s arcane_explosion Fluffy_Pillow 43491.5/69457: 63% mana arcane_charge(2)
4:54.839 aoe r arcane_missiles Fluffy_Pillow 40271.0/69457: 58% mana arcane_charge(3), clearcasting
4:56.843 aoe s arcane_explosion Fluffy_Pillow 43054.9/69457: 62% mana arcane_charge(3)
4:58.126 aoe t arcane_barrage Fluffy_Pillow 39837.1/69457: 57% mana arcane_charge(4)
4:59.408 aoe s arcane_explosion Fluffy_Pillow 44396.3/69457: 64% mana
5:00.690 aoe s arcane_explosion Fluffy_Pillow 41177.2/69457: 59% mana arcane_charge
5:01.972 aoe s arcane_explosion Fluffy_Pillow 37958.1/69457: 55% mana arcane_charge(2), crimson_chorus

Stats

Level Bonus (60) Race Bonus (human) Raid-Buffed Unbuffed Gear Amount
Strength 198 0 198 198 0
Agility 306 0 306 306 0
Stamina 414 0 2027 1931 1517
Intellect 450 0 1795 1615 1089 (46)
Spirit 0 0 0 0 0
Health 40540 38620 0
Mana 69457 69457 0
Spell Power 1795 1615 0
Crit 14.54% 14.54% 334
Haste 17.33% 17.33% 572
Versatility 5.77% 5.77% 231
Mana Regen 1389 1389 0
Mastery 38.91% 38.91% 855
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="human"
source=default
spec=arcane
level=60
race=human
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

kul_tiran : 8873 dps, 4542 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8872.9 8872.9 16.7 / 0.188% 1092.8 / 12.3% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2044.8 1939.0 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
kul_tiran 8873
Arcane Barrage 3737 42.2% 50.0 6.01sec 22489 18183 Direct 149.8 6348 13118 7509 17.1%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.01 149.83 0.00 0.00 1.2368 0.0000 1124556.17 1124556.17 0.00% 18182.87 18182.87
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.86% 124.14 89 163 6347.58 2191 31003 6340.78 5506 7142 787865 787865 0.00%
crit 17.14% 25.69 7 44 13117.98 4383 62006 13099.88 7866 21955 336691 336691 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.00
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 918 1836 1049 14.4%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1050.31 1050.31 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.60% 0.86 0 1 918.10 918 918 785.88 0 918 786 786 0.00%
crit 14.40% 0.14 0 1 1836.19 1836 1836 264.43 0 1836 264 264 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2927 33.0% 129.5 2.29sec 6792 5508 Direct 388.6 1916 3934 2264 17.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.53 388.58 0.00 0.00 1.2332 0.0000 879705.47 879705.47 0.00% 5507.52 5507.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 321.50 237 406 1916.08 1465 3604 1916.12 1808 2051 615904 615904 0.00%
crit 17.26% 67.08 37 102 3933.76 2929 7208 3933.57 3364 4656 263802 263802 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.52
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1008 11.4% 24.4 12.13sec 12418 6534 Periodic 194.6 1325 2696 1557 16.9% 4.5%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.41 0.00 194.71 194.58 1.9004 0.2066 303115.83 303115.83 0.00% 6534.50 6534.50
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.07% 161.64 78 257 1325.49 1074 2641 1324.65 1113 1643 214274 214274 0.00%
crit 16.93% 32.94 9 61 2696.22 2147 5283 2694.80 2201 3593 88842 88842 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.41
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (595) 0.0% (6.7%) 12.7 24.31sec 14093 11366

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.69 0.00 0.00 0.00 1.2399 0.0000 0.00 0.00 0.00% 11366.25 11366.25

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.69
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 595 6.7% 38.0 24.31sec 4706 0 Direct 38.0 3992 8132 4705 17.2%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.02 38.02 0.00 0.00 0.0000 0.0000 178904.79 178904.79 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.76% 31.46 16 43 3992.22 2895 7122 3993.33 3164 4629 125610 125610 0.00%
crit 17.24% 6.55 0 14 8132.32 5789 14244 8116.09 0 13438 53294 53294 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 16 (25) 0.2% (0.3%) 13.9 1.80sec 524 0 Periodic 40.8 (42.7) 114 0 114 0.0% (0.0%) 4.5%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.89 0.00 40.78 40.78 0.0000 0.9860 4659.94 4659.94 0.00% 180.84 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.78 15 68 114.26 0 204 114.11 70 174 4660 4660 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 9.63sec 1368 0 Direct 1.9 1124 2250 1369 21.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.91 1.91 0.00 0.00 0.0000 0.0000 2612.18 2612.18 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.36% 1.50 0 4 1124.09 1103 1169 1034.03 0 1169 1682 1682 0.00%
crit 21.64% 0.41 0 2 2250.46 2206 2338 831.22 0 2338 930 930 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.4 14.40sec 536 0 Direct 20.4 456 913 536 17.5%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.36 20.36 0.00 0.00 0.0000 0.0000 10915.41 10915.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.52% 16.80 7 33 456.40 448 475 456.41 448 470 7667 7667 0.00%
crit 17.48% 3.56 0 11 912.80 896 950 888.00 0 950 3249 3249 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4129 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 103  / 14 0.2% 90.0 1.31sec 46 35 Direct 90.0 39 78 46 18.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4129.10 4129.10 0.00% 34.57 34.57
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.57% 73.41 63 84 38.60 30 46 38.60 37 40 2833 2833 0.00%
crit 18.43% 16.59 6 27 78.09 60 92 78.12 67 88 1296 1296 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (527) 0.0% (5.9%) 6.2 52.23sec 25485 19812

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19811.88 19811.88

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 527 5.9% 6.2 52.13sec 25485 0 Direct 18.6 8526 0 8526 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.57 0.00 0.00 0.0000 0.0000 158197.86 158197.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.57 12 21 8526.03 240 39589 8513.40 5586 12391 158198 158198 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11371.10
  • base_dd_max:11371.10
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
kul_tiran
Arcane Power 2.9 127.15sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 220.79sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.50 0.00 2.98 0.00 4.2355 0.7105 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:kul_tiran
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.50
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:kul_tiran
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:kul_tiran
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.39sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 1.2377 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.08
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.27sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:kul_tiran
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.76
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.8 136.7 6.0sec 1.6sec 4.6sec 78.04% 0.00% 2.9 (4.0) 0.0

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 18.1s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.5s

Stack Uptimes

  • arcane_charge_1:20.63%
  • arcane_charge_2:17.72%
  • arcane_charge_3:16.81%
  • arcane_charge_4:22.88%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.1sec 127.1sec 14.7sec 14.05% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 138.4s
  • trigger_min/max:120.0s / 138.4s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.0s

Stack Uptimes

  • arcane_power_1:14.05%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.6 0.0 11.9sec 11.8sec 1.3sec 10.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.49%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.6sec 52.05% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 67.2s
  • trigger_min/max:60.0s / 67.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.95%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 172.7sec 172.7sec 4.2sec 0.70% 0.00% 2.0 (2.0) 0.0

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:124.7s / 220.8s
  • trigger_min/max:124.7s / 220.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 4.3s

Stack Uptimes

  • evocation_1:0.71%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.9 0.0 85.8sec 85.8sec 14.6sec 19.12% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 138.2s
  • trigger_min/max:60.0s / 138.2s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.12%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 35.02% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 60.9s
  • trigger_min/max:12.1s / 60.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.02%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.92% 0.76% 6.14% 0.9s 0.0s 5.3s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation217.24734.675354.478268.009151.462359.985
Rune of Power6.0980.00030.50638.56316.25378.201
Touch of the Magi4.8470.00047.42031.58814.67076.620
Arcane Power5.0590.00018.40914.7881.78627.863
Arcane Barrage3.5230.00314.239177.930139.862219.077
Arcane Orb4.2570.00016.73754.73031.16687.464

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
kul_tiran
mana_regen Mana 1048.90 405956.30 69.61% 387.03 9516.06 2.29%
Evocation Mana 23.28 26151.31 4.48% 1123.23 0.00 0.00%
Mana Gem Mana 2.76 19102.91 3.28% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.00 131960.05 22.63% 2639.20 6371.38 4.61%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1939.02 2044.78 15870.5 37354.3 745.8 69165.7
Usage Type Count Total Avg RPE APR
kul_tiran
arcane_explosion Mana 129.5 592334.7 4573.2 4573.1 1.5
arcane_orb Mana 12.7 5771.6 454.7 454.6 31.0
touch_of_the_magi Mana 6.2 15507.1 2499.3 2498.1 10.2

Statistics & Data Analysis

Fight Length
kul_tiran Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
kul_tiran Damage Per Second
Count 1118
Mean 8872.86
Minimum 8039.04
Maximum 9706.29
Spread ( max - min ) 1667.25
Range [ ( max - min ) / 2 * 100% ] 9.40%
Standard Deviation 285.0560
5th Percentile 8414.89
95th Percentile 9346.33
( 95th Percentile - 5th Percentile ) 931.44
Mean Distribution
Standard Deviation 8.5253
95.00% Confidence Interval ( 8856.15 - 8889.57 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 3965
0.1 Scale Factor Error with Delta=300 694
0.05 Scale Factor Error with Delta=300 2775
0.01 Scale Factor Error with Delta=300 69366
Priority Target DPS
kul_tiran Priority Target Damage Per Second
Count 1118
Mean 4541.92
Minimum 4003.86
Maximum 5232.28
Spread ( max - min ) 1228.42
Range [ ( max - min ) / 2 * 100% ] 13.52%
Standard Deviation 204.7684
5th Percentile 4207.41
95th Percentile 4859.67
( 95th Percentile - 5th Percentile ) 652.25
Mean Distribution
Standard Deviation 6.1241
95.00% Confidence Interval ( 4529.92 - 4553.92 )
Normalized 95.00% Confidence Interval ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 79
0.1% Error 7809
0.1 Scale Factor Error with Delta=300 358
0.05 Scale Factor Error with Delta=300 1432
0.01 Scale Factor Error with Delta=300 35794
DPS(e)
kul_tiran Damage Per Second (Effective)
Count 1118
Mean 8872.86
Minimum 8039.04
Maximum 9706.29
Spread ( max - min ) 1667.25
Range [ ( max - min ) / 2 * 100% ] 9.40%
Damage
kul_tiran Damage
Count 1118
Mean 2663717.96
Minimum 2022547.94
Maximum 3251717.67
Spread ( max - min ) 1229169.73
Range [ ( max - min ) / 2 * 100% ] 23.07%
DTPS
kul_tiran Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
kul_tiran Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
kul_tiran Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
kul_tiran Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
kul_tiran Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
kul_tiran Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
kul_tiranTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
kul_tiran Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.08 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.69 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.41 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.52 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.00 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.50 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.76 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.94 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxtqtsssstssrssptsrsssvtqtsrsrsstssssrtsssstqtsrssstsssstnxptqtssrsstssrsstsrsrsstqtsrssstssnprtsssstqtssssoxtsssstsssvrstqtsssrstnptssssrtqtssssrtsssstsssrstqtssrsrsrtnptssssrtqtsssrstssssrtssrsstqtssssrtvnoxtsssstqtssssptsrsrsrstqrtssss

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask kul_tiran 69165.7/69166: 100% mana
Pre precombat U food kul_tiran 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana
0:01.286 aoe o arcane_power Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, crimson_chorus
0:01.286 shared_cds w potion Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:01.286 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.286 aoe t arcane_barrage Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.277 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.266 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.255 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.245 aoe s arcane_explosion Fluffy_Pillow 68035.2/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.236 aoe s arcane_explosion Fluffy_Pillow 66906.1/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.227 aoe s arcane_explosion Fluffy_Pillow 65776.9/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.217 aoe t arcane_barrage Fluffy_Pillow 64646.4/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.207 aoe s arcane_explosion Fluffy_Pillow 68782.5/69166: 99% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.196 aoe s arcane_explosion Fluffy_Pillow 67650.6/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.187 aoe r arcane_missiles Fluffy_Pillow 66521.5/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.700 aoe s arcane_explosion Fluffy_Pillow 68614.4/69166: 99% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.692 aoe s arcane_explosion Fluffy_Pillow 67486.7/69166: 98% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.682 aoe p rune_of_power Fluffy_Pillow 66356.2/69166: 96% mana bloodlust, arcane_charge(4), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.673 aoe t arcane_barrage Fluffy_Pillow 67727.0/69166: 98% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.664 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:17.657 aoe r arcane_missiles Fluffy_Pillow 65539.3/69166: 95% mana bloodlust, arcane_charge, clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.157 aoe s arcane_explosion Fluffy_Pillow 67614.3/69166: 98% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.146 aoe s arcane_explosion Fluffy_Pillow 63982.4/69166: 93% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.136 aoe s arcane_explosion Fluffy_Pillow 60351.9/69166: 87% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.127 shared_cds v use_mana_gem kul_tiran 56722.8/69166: 82% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.127 aoe t arcane_barrage Fluffy_Pillow 63639.3/69166: 92% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.118 aoe q arcane_orb Fluffy_Pillow 67776.8/69166: 98% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.110 aoe t arcane_barrage Fluffy_Pillow 68649.1/69166: 99% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.101 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.092 aoe r arcane_missiles Fluffy_Pillow 65536.6/69166: 95% mana bloodlust, arcane_charge, clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.705 aoe s arcane_explosion Fluffy_Pillow 67767.9/69166: 98% mana bloodlust, arcane_charge, crimson_chorus(3)
0:28.695 aoe r arcane_missiles Fluffy_Pillow 64137.3/69166: 93% mana bloodlust, arcane_charge(2), clearcasting, crimson_chorus(3)
0:30.323 aoe s arcane_explosion Fluffy_Pillow 66389.4/69166: 96% mana bloodlust, arcane_charge(2)
0:31.312 aoe s arcane_explosion Fluffy_Pillow 62757.5/69166: 91% mana bloodlust, arcane_charge(3)
0:32.302 aoe t arcane_barrage Fluffy_Pillow 59127.0/69166: 85% mana bloodlust, arcane_charge(4)
0:33.294 aoe s arcane_explosion Fluffy_Pillow 63265.8/69166: 91% mana bloodlust
0:34.285 aoe s arcane_explosion Fluffy_Pillow 59636.7/69166: 86% mana bloodlust, arcane_charge
0:35.275 aoe s arcane_explosion Fluffy_Pillow 56006.2/69166: 81% mana bloodlust, arcane_charge(2)
0:36.265 aoe s arcane_explosion Fluffy_Pillow 52375.7/69166: 76% mana bloodlust, arcane_charge(3)
0:37.257 aoe r arcane_missiles Fluffy_Pillow 48747.9/69166: 70% mana bloodlust, arcane_charge(4), clearcasting
0:38.794 aoe t arcane_barrage Fluffy_Pillow 50874.1/69166: 74% mana bloodlust, arcane_charge(4)
0:39.786 aoe s arcane_explosion Fluffy_Pillow 55012.9/69166: 80% mana bloodlust
0:40.777 aoe s arcane_explosion Fluffy_Pillow 51383.8/69166: 74% mana bloodlust, arcane_charge
0:41.769 aoe s arcane_explosion Fluffy_Pillow 47756.1/69166: 69% mana arcane_charge(2)
0:43.056 aoe s arcane_explosion Fluffy_Pillow 44536.4/69166: 64% mana arcane_charge(3)
0:44.344 aoe t arcane_barrage Fluffy_Pillow 41318.1/69166: 60% mana arcane_charge(4)
0:45.632 aoe q arcane_orb Fluffy_Pillow 45866.4/69166: 66% mana
0:46.918 aoe t arcane_barrage Fluffy_Pillow 47145.4/69166: 68% mana arcane_charge(4)
0:48.205 aoe s arcane_explosion Fluffy_Pillow 51692.3/69166: 75% mana
0:49.490 aoe r arcane_missiles Fluffy_Pillow 48469.9/69166: 70% mana arcane_charge, clearcasting
0:51.417 aoe s arcane_explosion Fluffy_Pillow 51135.5/69166: 74% mana arcane_charge
0:52.703 aoe s arcane_explosion Fluffy_Pillow 47914.5/69166: 69% mana arcane_charge(2)
0:53.991 aoe s arcane_explosion Fluffy_Pillow 44696.2/69166: 65% mana arcane_charge(3)
0:55.278 aoe t arcane_barrage Fluffy_Pillow 41476.5/69166: 60% mana arcane_charge(4)
0:56.565 aoe s arcane_explosion Fluffy_Pillow 46023.5/69166: 67% mana
0:57.851 aoe s arcane_explosion Fluffy_Pillow 42802.4/69166: 62% mana arcane_charge
0:59.137 aoe s arcane_explosion Fluffy_Pillow 39581.3/69166: 57% mana arcane_charge(2)
1:00.424 aoe s arcane_explosion Fluffy_Pillow 36361.7/69166: 53% mana arcane_charge(3)
1:01.711 aoe t arcane_barrage Fluffy_Pillow 33142.0/69166: 48% mana arcane_charge(4), crimson_chorus
1:02.997 aoe n touch_of_the_magi Fluffy_Pillow 37687.6/69166: 54% mana crimson_chorus
1:04.285 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 36969.3/69166: 53% mana arcane_charge(4), crimson_chorus
1:04.285 aoe p rune_of_power Fluffy_Pillow 36969.3/69166: 53% mana arcane_charge(4), crimson_chorus, gladiators_badge
1:05.571 aoe t arcane_barrage Fluffy_Pillow 38748.2/69166: 56% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:06.857 aoe q arcane_orb Fluffy_Pillow 43293.8/69166: 63% mana rune_of_power, crimson_chorus, gladiators_badge
1:08.141 aoe t arcane_barrage Fluffy_Pillow 44570.0/69166: 64% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:09.428 aoe s arcane_explosion Fluffy_Pillow 49116.9/69166: 71% mana rune_of_power, crimson_chorus, gladiators_badge
1:10.714 aoe s arcane_explosion Fluffy_Pillow 45895.9/69166: 66% mana arcane_charge, rune_of_power, crimson_chorus(2), gladiators_badge
1:12.001 aoe r arcane_missiles Fluffy_Pillow 42676.2/69166: 62% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
1:14.021 aoe s arcane_explosion Fluffy_Pillow 45470.5/69166: 66% mana arcane_charge(2), rune_of_power, crimson_chorus(2), gladiators_badge
1:15.307 aoe s arcane_explosion Fluffy_Pillow 42249.4/69166: 61% mana arcane_charge(3), rune_of_power, crimson_chorus(2), gladiators_badge
1:16.593 aoe t arcane_barrage Fluffy_Pillow 39028.4/69166: 56% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
1:17.880 aoe s arcane_explosion Fluffy_Pillow 43575.3/69166: 63% mana crimson_chorus(2), gladiators_badge
1:19.168 aoe s arcane_explosion Fluffy_Pillow 40357.0/69166: 58% mana arcane_charge, crimson_chorus(2), gladiators_badge
1:20.455 aoe r arcane_missiles Fluffy_Pillow 37137.4/69166: 54% mana arcane_charge(2), clearcasting, crimson_chorus(3)
1:22.357 aoe s arcane_explosion Fluffy_Pillow 39768.4/69166: 57% mana arcane_charge(2), crimson_chorus(3)
1:23.643 aoe s arcane_explosion Fluffy_Pillow 36547.4/69166: 53% mana arcane_charge(3), crimson_chorus(3)
1:24.929 aoe t arcane_barrage Fluffy_Pillow 33326.3/69166: 48% mana arcane_charge(4), crimson_chorus(3)
1:26.216 aoe s arcane_explosion Fluffy_Pillow 37873.3/69166: 55% mana crimson_chorus(3)
1:27.501 aoe r arcane_missiles Fluffy_Pillow 34650.8/69166: 50% mana arcane_charge, clearcasting, crimson_chorus(3)
1:29.571 aoe s arcane_explosion Fluffy_Pillow 37514.3/69166: 54% mana arcane_charge, crimson_chorus(3)
1:30.857 aoe r arcane_missiles Fluffy_Pillow 34293.2/69166: 50% mana arcane_charge(2), clearcasting
1:32.795 aoe s arcane_explosion Fluffy_Pillow 36974.1/69166: 53% mana arcane_charge(2)
1:34.083 aoe s arcane_explosion Fluffy_Pillow 33755.8/69166: 49% mana arcane_charge(3)
1:35.369 aoe t arcane_barrage Fluffy_Pillow 30534.7/69166: 44% mana arcane_charge(4)
1:36.655 aoe q arcane_orb Fluffy_Pillow 35080.3/69166: 51% mana
1:37.943 aoe t arcane_barrage Fluffy_Pillow 36362.0/69166: 53% mana arcane_charge(4)
1:39.229 aoe s arcane_explosion Fluffy_Pillow 40907.6/69166: 59% mana
1:40.515 aoe r arcane_missiles Fluffy_Pillow 37686.5/69166: 54% mana arcane_charge, clearcasting
1:42.530 aoe s arcane_explosion Fluffy_Pillow 40473.9/69166: 59% mana arcane_charge
1:43.816 aoe s arcane_explosion Fluffy_Pillow 37252.8/69166: 54% mana arcane_charge(2)
1:45.104 aoe s arcane_explosion Fluffy_Pillow 34034.5/69166: 49% mana arcane_charge(3)
1:46.390 aoe t arcane_barrage Fluffy_Pillow 30813.5/69166: 45% mana arcane_charge(4)
1:47.677 aoe s arcane_explosion Fluffy_Pillow 35360.4/69166: 51% mana
1:48.963 aoe s arcane_explosion Fluffy_Pillow 32139.4/69166: 46% mana arcane_charge
1:50.250 aoe n touch_of_the_magi Fluffy_Pillow 28919.7/69166: 42% mana arcane_charge(2), clearcasting
1:51.536 aoe p rune_of_power Fluffy_Pillow 28198.7/69166: 41% mana arcane_charge(4), clearcasting
1:52.823 aoe r arcane_missiles Fluffy_Pillow 29979.0/69166: 43% mana arcane_charge(4), clearcasting, rune_of_power
1:54.888 aoe t arcane_barrage Fluffy_Pillow 32835.5/69166: 47% mana arcane_charge(4), rune_of_power
1:56.172 aoe s arcane_explosion Fluffy_Pillow 37378.3/69166: 54% mana rune_of_power
1:57.457 aoe s arcane_explosion Fluffy_Pillow 34155.9/69166: 49% mana arcane_charge, rune_of_power
1:58.743 aoe s arcane_explosion Fluffy_Pillow 30934.8/69166: 45% mana arcane_charge(2), rune_of_power
2:00.031 aoe s arcane_explosion Fluffy_Pillow 27716.5/69166: 40% mana arcane_charge(3), rune_of_power
2:01.316 aoe t arcane_barrage Fluffy_Pillow 24494.1/69166: 35% mana arcane_charge(4), rune_of_power
2:02.603 aoe q arcane_orb Fluffy_Pillow 29041.1/69166: 42% mana rune_of_power, crimson_chorus
2:03.889 aoe t arcane_barrage Fluffy_Pillow 30320.0/69166: 44% mana arcane_charge(4), rune_of_power, crimson_chorus
2:05.176 aoe s arcane_explosion Fluffy_Pillow 34866.9/69166: 50% mana crimson_chorus
2:06.464 aoe s arcane_explosion Fluffy_Pillow 31648.7/69166: 46% mana arcane_charge, crimson_chorus
2:07.753 aoe s arcane_explosion Fluffy_Pillow 28431.7/69166: 41% mana arcane_charge(2), crimson_chorus
2:09.039 aoe s arcane_explosion Fluffy_Pillow 25210.7/69166: 36% mana arcane_charge(3), crimson_chorus
2:10.324 aoe o arcane_power Fluffy_Pillow 21988.3/69166: 32% mana arcane_charge(4), crimson_chorus
2:10.324 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 21988.3/69166: 32% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:10.324 aoe t arcane_barrage Fluffy_Pillow 21988.3/69166: 32% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:11.611 aoe s arcane_explosion Fluffy_Pillow 26535.2/69166: 38% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:12.898 aoe s arcane_explosion Fluffy_Pillow 25815.5/69166: 37% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.182 aoe s arcane_explosion Fluffy_Pillow 25091.7/69166: 36% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.469 aoe s arcane_explosion Fluffy_Pillow 24372.0/69166: 35% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.753 aoe t arcane_barrage Fluffy_Pillow 23648.2/69166: 34% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.039 aoe s arcane_explosion Fluffy_Pillow 28193.8/69166: 41% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.327 aoe s arcane_explosion Fluffy_Pillow 27475.5/69166: 40% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.615 aoe s arcane_explosion Fluffy_Pillow 26757.2/69166: 39% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:21.903 shared_cds v use_mana_gem kul_tiran 26038.9/69166: 38% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
2:22.127 aoe r arcane_missiles Fluffy_Pillow 33265.3/69166: 48% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
2:24.149 aoe s arcane_explosion Fluffy_Pillow 36062.4/69166: 52% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
2:25.436 aoe t arcane_barrage Fluffy_Pillow 35342.7/69166: 51% mana arcane_charge(4), crimson_chorus(3)
2:26.721 aoe q arcane_orb Fluffy_Pillow 39886.9/69166: 58% mana crimson_chorus(3)
2:28.008 aoe t arcane_barrage Fluffy_Pillow 41167.2/69166: 60% mana arcane_charge(4), crimson_chorus(3)
2:29.294 aoe s arcane_explosion Fluffy_Pillow 45712.8/69166: 66% mana crimson_chorus(3)
2:30.578 aoe s arcane_explosion Fluffy_Pillow 42489.0/69166: 61% mana arcane_charge, crimson_chorus(3)
2:31.865 aoe s arcane_explosion Fluffy_Pillow 39269.3/69166: 57% mana arcane_charge(2)
2:33.152 aoe r arcane_missiles Fluffy_Pillow 36049.6/69166: 52% mana arcane_charge(3), clearcasting
2:35.249 aoe s arcane_explosion Fluffy_Pillow 38950.4/69166: 56% mana arcane_charge(3)
2:36.535 aoe t arcane_barrage Fluffy_Pillow 35729.4/69166: 52% mana arcane_charge(4)
2:37.822 aoe n touch_of_the_magi Fluffy_Pillow 40276.3/69166: 58% mana
2:39.111 aoe p rune_of_power Fluffy_Pillow 39559.4/69166: 57% mana arcane_charge(4)
2:40.396 aoe t arcane_barrage Fluffy_Pillow 41337.0/69166: 60% mana arcane_charge(4), rune_of_power
2:41.685 aoe s arcane_explosion Fluffy_Pillow 45886.7/69166: 66% mana rune_of_power
2:42.972 aoe s arcane_explosion Fluffy_Pillow 42667.0/69166: 62% mana arcane_charge, rune_of_power
2:44.258 aoe s arcane_explosion Fluffy_Pillow 39446.0/69166: 57% mana arcane_charge(2), rune_of_power
2:45.546 aoe s arcane_explosion Fluffy_Pillow 36227.7/69166: 52% mana arcane_charge(3), rune_of_power
2:46.830 aoe r arcane_missiles Fluffy_Pillow 33003.9/69166: 48% mana arcane_charge(4), clearcasting, rune_of_power
2:48.811 aoe t arcane_barrage Fluffy_Pillow 35744.2/69166: 52% mana arcane_charge(4), rune_of_power
2:50.097 aoe q arcane_orb Fluffy_Pillow 40289.8/69166: 58% mana rune_of_power
2:51.383 aoe t arcane_barrage Fluffy_Pillow 41568.7/69166: 60% mana arcane_charge(4), rune_of_power
2:52.670 aoe s arcane_explosion Fluffy_Pillow 46115.7/69166: 67% mana
2:53.957 aoe s arcane_explosion Fluffy_Pillow 42896.0/69166: 62% mana arcane_charge
2:55.243 aoe s arcane_explosion Fluffy_Pillow 39674.9/69166: 57% mana arcane_charge(2)
2:56.531 aoe s arcane_explosion Fluffy_Pillow 36456.7/69166: 53% mana arcane_charge(3)
2:57.818 aoe r arcane_missiles Fluffy_Pillow 33237.0/69166: 48% mana arcane_charge(4), clearcasting
2:59.854 aoe t arcane_barrage Fluffy_Pillow 36053.4/69166: 52% mana arcane_charge(4)
3:01.139 aoe s arcane_explosion Fluffy_Pillow 40597.6/69166: 59% mana
3:02.425 aoe s arcane_explosion Fluffy_Pillow 37376.5/69166: 54% mana arcane_charge
3:03.712 aoe s arcane_explosion Fluffy_Pillow 34156.9/69166: 49% mana arcane_charge(2), crimson_chorus
3:04.997 aoe s arcane_explosion Fluffy_Pillow 30934.4/69166: 45% mana arcane_charge(3), crimson_chorus
3:06.284 aoe t arcane_barrage Fluffy_Pillow 27714.7/69166: 40% mana arcane_charge(4), crimson_chorus
3:07.572 aoe s arcane_explosion Fluffy_Pillow 32263.1/69166: 47% mana crimson_chorus
3:08.858 aoe s arcane_explosion Fluffy_Pillow 29042.0/69166: 42% mana arcane_charge, crimson_chorus
3:10.144 aoe s arcane_explosion Fluffy_Pillow 25821.0/69166: 37% mana arcane_charge(2), crimson_chorus
3:11.429 aoe r arcane_missiles Fluffy_Pillow 22598.5/69166: 33% mana arcane_charge(3), clearcasting, crimson_chorus
3:13.357 aoe s arcane_explosion Fluffy_Pillow 25265.6/69166: 37% mana arcane_charge(3), crimson_chorus(2)
3:14.643 aoe t arcane_barrage Fluffy_Pillow 22044.5/69166: 32% mana arcane_charge(4), crimson_chorus(2)
3:15.927 aoe q arcane_orb Fluffy_Pillow 26587.3/69166: 38% mana crimson_chorus(2)
3:17.214 aoe t arcane_barrage Fluffy_Pillow 27867.6/69166: 40% mana arcane_charge(4), crimson_chorus(2)
3:18.500 aoe s arcane_explosion Fluffy_Pillow 32413.2/69166: 47% mana crimson_chorus(2)
3:19.787 aoe s arcane_explosion Fluffy_Pillow 29193.5/69166: 42% mana arcane_charge, crimson_chorus(2)
3:21.074 aoe r arcane_missiles Fluffy_Pillow 25973.9/69166: 38% mana arcane_charge(2), clearcasting, crimson_chorus(2)
3:23.127 aoe s arcane_explosion Fluffy_Pillow 28813.8/69166: 42% mana arcane_charge(2), crimson_chorus(3)
3:24.412 aoe r arcane_missiles Fluffy_Pillow 25591.4/69166: 37% mana arcane_charge(3), clearcasting, crimson_chorus(3)
3:26.451 aoe s arcane_explosion Fluffy_Pillow 28411.9/69166: 41% mana arcane_charge(3), crimson_chorus(3)
3:27.739 aoe r arcane_missiles Fluffy_Pillow 25193.6/69166: 36% mana arcane_charge(4), clearcasting, crimson_chorus(3)
3:29.702 aoe t arcane_barrage Fluffy_Pillow 27909.1/69166: 40% mana arcane_charge(4), crimson_chorus(3)
3:30.989 aoe n touch_of_the_magi Fluffy_Pillow 32456.0/69166: 47% mana crimson_chorus(3)
3:32.276 aoe p rune_of_power Fluffy_Pillow 31736.4/69166: 46% mana arcane_charge(4), crimson_chorus(3)
3:33.563 aoe t arcane_barrage Fluffy_Pillow 33516.7/69166: 48% mana arcane_charge(4), rune_of_power
3:34.849 aoe s arcane_explosion Fluffy_Pillow 38062.3/69166: 55% mana rune_of_power
3:36.136 aoe s arcane_explosion Fluffy_Pillow 34842.6/69166: 50% mana arcane_charge, rune_of_power
3:37.422 aoe s arcane_explosion Fluffy_Pillow 31621.5/69166: 46% mana arcane_charge(2), rune_of_power
3:38.707 aoe s arcane_explosion Fluffy_Pillow 28399.1/69166: 41% mana arcane_charge(3), rune_of_power
3:39.994 aoe r arcane_missiles Fluffy_Pillow 25179.4/69166: 36% mana arcane_charge(4), clearcasting, rune_of_power
3:42.025 aoe t arcane_barrage Fluffy_Pillow 27988.9/69166: 40% mana arcane_charge(4), rune_of_power
3:43.311 aoe q arcane_orb Fluffy_Pillow 32534.5/69166: 47% mana rune_of_power
3:44.600 aoe t arcane_barrage Fluffy_Pillow 33817.6/69166: 49% mana arcane_charge(4), rune_of_power
3:45.886 aoe s arcane_explosion Fluffy_Pillow 38363.2/69166: 55% mana
3:47.171 aoe s arcane_explosion Fluffy_Pillow 35140.7/69166: 51% mana arcane_charge
3:48.458 aoe s arcane_explosion Fluffy_Pillow 31921.0/69166: 46% mana arcane_charge(2)
3:49.743 aoe r arcane_missiles Fluffy_Pillow 28698.6/69166: 41% mana arcane_charge(3), clearcasting
3:51.685 aoe s arcane_explosion Fluffy_Pillow 31385.0/69166: 45% mana arcane_charge(3)
3:52.970 aoe t arcane_barrage Fluffy_Pillow 28162.6/69166: 41% mana arcane_charge(4)
3:54.258 aoe s arcane_explosion Fluffy_Pillow 32710.9/69166: 47% mana
3:55.544 aoe s arcane_explosion Fluffy_Pillow 29489.8/69166: 43% mana arcane_charge
3:56.831 aoe s arcane_explosion Fluffy_Pillow 26270.2/69166: 38% mana arcane_charge(2)
3:58.119 aoe s arcane_explosion Fluffy_Pillow 23051.9/69166: 33% mana arcane_charge(3)
3:59.406 aoe r arcane_missiles Fluffy_Pillow 19832.2/69166: 29% mana arcane_charge(4), clearcasting
4:01.355 aoe t arcane_barrage Fluffy_Pillow 22528.3/69166: 33% mana arcane_charge(4)
4:02.641 aoe s arcane_explosion Fluffy_Pillow 27073.8/69166: 39% mana
4:03.927 aoe s arcane_explosion Fluffy_Pillow 23852.8/69166: 34% mana arcane_charge, crimson_chorus
4:05.214 aoe r arcane_missiles Fluffy_Pillow 20633.1/69166: 30% mana arcane_charge(2), clearcasting, crimson_chorus
4:07.116 aoe s arcane_explosion Fluffy_Pillow 23264.2/69166: 34% mana arcane_charge(2), crimson_chorus
4:08.403 aoe s arcane_explosion Fluffy_Pillow 20044.5/69166: 29% mana arcane_charge(3), crimson_chorus
4:09.689 aoe t arcane_barrage Fluffy_Pillow 16823.4/69166: 24% mana arcane_charge(4), crimson_chorus
4:10.976 aoe q arcane_orb Fluffy_Pillow 21370.4/69166: 31% mana crimson_chorus
4:12.262 aoe t arcane_barrage Fluffy_Pillow 22649.3/69166: 33% mana arcane_charge(4), crimson_chorus
4:13.549 aoe s arcane_explosion Fluffy_Pillow 27196.3/69166: 39% mana crimson_chorus(2)
4:14.835 aoe s arcane_explosion Fluffy_Pillow 23975.2/69166: 35% mana arcane_charge, crimson_chorus(2)
4:16.121 aoe s arcane_explosion Fluffy_Pillow 20754.2/69166: 30% mana arcane_charge(2), crimson_chorus(2)
4:17.408 aoe s arcane_explosion Fluffy_Pillow 17534.5/69166: 25% mana arcane_charge(3), crimson_chorus(2)
4:18.697 aoe r arcane_missiles Fluffy_Pillow 14317.6/69166: 21% mana arcane_charge(4), clearcasting, crimson_chorus(2)
4:20.639 aoe t arcane_barrage Fluffy_Pillow 17004.0/69166: 25% mana arcane_charge(4), crimson_chorus(2)
4:21.925 shared_cds v use_mana_gem kul_tiran 21549.6/69166: 31% mana crimson_chorus(2)
4:22.127 aoe n touch_of_the_magi Fluffy_Pillow 28745.6/69166: 42% mana crimson_chorus(2)
4:23.415 aoe o arcane_power Fluffy_Pillow 28027.3/69166: 41% mana arcane_charge(4), crimson_chorus(3)
4:23.415 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 28027.3/69166: 41% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3)
4:23.415 aoe t arcane_barrage Fluffy_Pillow 28027.3/69166: 41% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:24.702 aoe s arcane_explosion Fluffy_Pillow 32574.2/69166: 47% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.990 aoe s arcane_explosion Fluffy_Pillow 31855.9/69166: 46% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.276 aoe s arcane_explosion Fluffy_Pillow 31134.9/69166: 45% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:28.561 aoe s arcane_explosion Fluffy_Pillow 30412.4/69166: 44% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:29.848 aoe t arcane_barrage Fluffy_Pillow 29692.8/69166: 43% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:31.136 aoe q arcane_orb Fluffy_Pillow 34241.1/69166: 50% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:32.422 aoe t arcane_barrage Fluffy_Pillow 35770.0/69166: 52% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:33.709 aoe s arcane_explosion Fluffy_Pillow 40317.0/69166: 58% mana arcane_power, rune_of_power, gladiators_badge
4:34.996 aoe s arcane_explosion Fluffy_Pillow 39597.3/69166: 57% mana arcane_charge, arcane_power, rune_of_power, gladiators_badge
4:36.281 aoe s arcane_explosion Fluffy_Pillow 38874.9/69166: 56% mana arcane_charge(2), arcane_power, gladiators_badge
4:37.567 aoe s arcane_explosion Fluffy_Pillow 38153.8/69166: 55% mana arcane_charge(3), arcane_power, gladiators_badge
4:38.852 aoe p rune_of_power Fluffy_Pillow 37431.4/69166: 54% mana arcane_charge(4)
4:40.139 aoe t arcane_barrage Fluffy_Pillow 39211.7/69166: 57% mana arcane_charge(4), rune_of_power
4:41.426 aoe s arcane_explosion Fluffy_Pillow 43758.7/69166: 63% mana rune_of_power
4:42.713 aoe r arcane_missiles Fluffy_Pillow 40539.0/69166: 59% mana arcane_charge, clearcasting, rune_of_power
4:44.730 aoe s arcane_explosion Fluffy_Pillow 43329.1/69166: 63% mana arcane_charge, rune_of_power
4:46.016 aoe r arcane_missiles Fluffy_Pillow 40108.1/69166: 58% mana arcane_charge(2), clearcasting, rune_of_power
4:48.054 aoe s arcane_explosion Fluffy_Pillow 42927.3/69166: 62% mana arcane_charge(2), rune_of_power
4:49.342 aoe r arcane_missiles Fluffy_Pillow 39709.0/69166: 57% mana arcane_charge(3), clearcasting, rune_of_power
4:51.259 aoe s arcane_explosion Fluffy_Pillow 42360.8/69166: 61% mana arcane_charge(3), rune_of_power
4:52.546 aoe t arcane_barrage Fluffy_Pillow 39141.1/69166: 57% mana arcane_charge(4)
4:53.832 aoe q arcane_orb Fluffy_Pillow 43686.7/69166: 63% mana
4:55.120 aoe r arcane_missiles Fluffy_Pillow 44968.4/69166: 65% mana arcane_charge(4), clearcasting
4:57.014 aoe t arcane_barrage Fluffy_Pillow 47588.4/69166: 69% mana arcane_charge(4)
4:58.302 aoe s arcane_explosion Fluffy_Pillow 52136.7/69166: 75% mana
4:59.590 aoe s arcane_explosion Fluffy_Pillow 48918.4/69166: 71% mana arcane_charge
5:00.877 aoe s arcane_explosion Fluffy_Pillow 45698.8/69166: 66% mana arcane_charge(2)
5:02.165 aoe s arcane_explosion Fluffy_Pillow 42480.5/69166: 61% mana arcane_charge(3)

Stats

Level Bonus (60) Race Bonus (kul_tiran) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 -2 304 304 0
Stamina 414 2 2029 1933 1517
Intellect 450 -1 1794 1614 1089 (46)
Spirit 0 0 0 0 0
Health 40580 38660 0
Mana 69166 69166 0
Spell Power 1794 1614 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 6.65% 6.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="kul_tiran"
source=default
spec=arcane
level=60
race=kul_tiran
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

lightforged draenei : 8920 dps, 4528 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8919.8 8919.8 15.7 / 0.176% 1058.8 / 11.9% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2020.3 1915.5 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lightforged draenei 8920
Arcane Barrage 3683 41.3% 49.6 6.06sec 22337 18042 Direct 148.7 6337 12871 7457 17.1%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.62 148.67 0.00 0.00 1.2381 0.0000 1108336.03 1108336.03 0.00% 18041.67 18041.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.86% 123.18 88 158 6336.89 2172 30728 6328.86 5415 7134 780229 780229 0.00%
crit 17.14% 25.48 10 42 12870.64 4344 61455 12871.43 7385 19306 328108 328108 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:49.63
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 3 0.0% 0.0 0.00sec 0 0 Direct 1.0 910 1820 1034 13.5%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1032.90 1032.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.49% 0.86 0 1 910.00 910 910 787.09 0 910 787 787 0.00%
crit 13.51% 0.14 0 1 1819.99 1820 1820 245.81 0 1820 246 246 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2874 32.2% 128.1 2.31sec 6743 5465 Direct 384.3 1902 3917 2248 17.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 128.09 384.26 0.00 0.00 1.2339 0.0000 863647.23 863647.23 0.00% 5464.70 5464.70
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.83% 318.27 238 401 1901.84 1452 3572 1901.99 1753 2039 605198 605198 0.00%
crit 17.17% 65.98 34 100 3917.08 2903 7144 3916.43 3318 4652 258449 258449 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:128.10
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 993 11.1% 24.2 12.09sec 12351 6499 Periodic 192.6 1316 2690 1549 17.0% 4.4%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.17 0.00 192.75 192.63 1.9006 0.2068 298470.30 298470.30 0.00% 6498.52 6498.52
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 83.03% 159.94 73 260 1316.00 1064 2618 1316.04 1118 1647 210520 210520 0.00%
crit 16.97% 32.70 13 63 2689.67 2128 5236 2688.40 2128 3397 87951 87951 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.15
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (590) 0.0% (6.6%) 12.7 24.45sec 13958 11258

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.71 0.00 0.00 0.00 1.2399 0.0000 0.00 0.00 0.00% 11257.56 11257.56

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.71
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 590 6.6% 38.1 24.45sec 4660 0 Direct 38.1 3951 8072 4663 17.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.07 38.07 0.00 0.00 0.0000 0.0000 177396.66 177396.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 31.50 16 42 3950.89 2869 7059 3948.40 3345 4599 124373 124373 0.00%
crit 17.26% 6.57 0 17 8072.48 5738 14118 8045.87 0 14118 53024 53024 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 16 (25) 0.2% (0.3%) 14.3 1.78sec 510 0 Periodic 41.1 (43.2) 112 0 112 0.0% (0.0%) 4.5%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.27 0.00 41.14 41.14 0.0000 0.9862 4603.32 4603.32 0.00% 179.35 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 41.14 14 64 111.88 0 202 111.97 70 163 4603 4603 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 2.0 9.59sec 1333 0 Direct 2.0 1114 2229 1336 19.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.01 2.01 0.00 0.00 0.0000 0.0000 2674.15 2674.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.38% 1.61 0 4 1114.29 1093 1158 1050.81 0 1158 1797 1797 0.00%
crit 19.62% 0.39 0 3 2229.17 2185 2316 777.88 0 2316 877 877 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.3 14.53sec 531 0 Direct 20.3 452 904 531 17.4%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.32 20.32 0.00 0.00 0.0000 0.0000 10785.66 10785.66 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 16.79 5 28 452.19 444 470 452.25 444 463 7594 7594 0.00%
crit 17.37% 3.53 0 10 903.89 887 941 882.89 0 941 3192 3192 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Light's Judgment 0 (181) 0.0% (2.0%) 2.5 150.46sec 21869 17002

Stats Details: Lights Judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.50 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 17001.67 17001.67

Action Details: Lights Judgment

  • id:255647
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:150.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:255647
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing $<damage> Holy damage to enemies within $A1 yards after 3 sec.

Action Priority List

    shared_cds
    [x]:2.49
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
    Light's Judgment (_damage) 181 2.0% 2.5 150.73sec 22034 0 Direct 7.4 6266 12564 7343 17.1%

Stats Details: Lights Judgment Damage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.48 7.45 0.00 0.00 0.0000 0.0000 54711.38 54711.38 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.85% 6.17 2 9 6265.81 5974 6999 6275.68 5974 6735 38666 38666 0.00%
crit 17.15% 1.28 0 5 12563.56 11947 13998 9319.74 0 13998 16045 16045 0.00%

Action Details: Lights Judgment Damage

  • id:256893
  • school:holy
  • range:40.0
  • travel_speed:0.0000
  • radius:5.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:150.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:256893
  • name:Light's Judgment
  • school:holy
  • tooltip:
  • description:Call down a strike of Holy energy, dealing $<damage> Holy damage to enemies within $A1 yards.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4078 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 102  / 14 0.2% 90.0 1.31sec 45 34 Direct 90.0 38 78 45 18.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4077.88 4077.88 0.00% 34.14 34.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.81% 73.63 62 85 38.15 30 46 38.15 37 39 2809 2809 0.00%
crit 18.19% 16.37 5 28 77.53 59 92 77.54 60 89 1269 1269 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (521) 0.0% (5.8%) 6.2 51.92sec 25295 20422

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.19 0.00 0.00 0.00 1.2387 0.0000 0.00 0.00 0.00% 20421.77 20421.77

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.22
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 521 5.8% 6.2 51.83sec 25295 0 Direct 18.5 8464 0 8464 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.19 18.52 0.00 0.00 0.0000 0.0000 156635.00 156635.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.52 12 21 8463.66 228 44111 8450.18 5511 12428 156635 156635 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10079.88
  • base_dd_max:10079.88
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
lightforged draenei
Arcane Power 2.9 127.01sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.4 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.41 0.00 2.42 0.00 4.1924 0.7094 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lightforged draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.41
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lightforged draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lightforged draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.21sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2376 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.07
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.81sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lightforged draenei
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.76
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.4 135.7 6.0sec 1.6sec 4.7sec 78.09% 0.00% 3.0 (4.2) 0.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 16.1s
  • trigger_min/max:0.0s / 8.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 14.6s

Stack Uptimes

  • arcane_charge_1:20.87%
  • arcane_charge_2:17.65%
  • arcane_charge_3:16.73%
  • arcane_charge_4:22.84%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.0sec 127.0sec 14.7sec 14.02% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 138.5s
  • trigger_min/max:120.0s / 138.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.02%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.3 0.0 11.9sec 11.9sec 1.3sec 10.52% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.51%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.04% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.5s
  • trigger_min/max:60.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.33%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.4 0.0 0.0sec 0.0sec 4.2sec 0.57% 0.00% 1.6 (1.6) 0.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:0.58%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.9 0.0 87.0sec 87.0sec 14.6sec 18.88% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 138.5s
  • trigger_min/max:60.0s / 138.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:18.88%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.9sec 34.9sec 11.8sec 34.94% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.2s / 56.3s
  • trigger_min/max:12.2s / 56.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.94%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.13% 0.96% 6.23% 1.0s 0.0s 4.1s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation222.95192.428352.769274.427152.913359.985
Rune of Power6.2470.00429.30339.14117.28076.611
Touch of the Magi4.9880.00025.32832.52015.99373.530
Arcane Power5.3410.00018.54215.5073.46228.523
Arcane Barrage3.5690.00413.343178.825139.642220.018
Arcane Orb4.2950.00019.51155.17529.81186.639

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
lightforged draenei
mana_regen Mana 1037.61 404796.96 70.25% 390.13 10667.70 2.57%
Evocation Mana 19.01 21355.45 3.71% 1123.50 0.00 0.00%
Mana Gem Mana 2.76 19060.22 3.31% 6916.57 0.00 0.00%
Arcane Barrage Mana 49.63 130999.83 22.73% 2639.69 6299.61 4.59%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1915.52 2020.26 16955.3 37660.0 1335.7 69165.7
Usage Type Count Total Avg RPE APR
lightforged draenei
arcane_explosion Mana 128.1 585061.7 4567.1 4567.7 1.5
arcane_orb Mana 12.7 5780.4 454.8 454.8 30.7
touch_of_the_magi Mana 6.2 15469.6 2499.3 2498.2 10.1

Statistics & Data Analysis

Fight Length
lightforged draenei Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
lightforged draenei Damage Per Second
Count 1118
Mean 8919.78
Minimum 8183.99
Maximum 9777.26
Spread ( max - min ) 1593.27
Range [ ( max - min ) / 2 * 100% ] 8.93%
Standard Deviation 268.4080
5th Percentile 8479.67
95th Percentile 9362.51
( 95th Percentile - 5th Percentile ) 882.84
Mean Distribution
Standard Deviation 8.0274
95.00% Confidence Interval ( 8904.05 - 8935.52 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3479
0.1 Scale Factor Error with Delta=300 615
0.05 Scale Factor Error with Delta=300 2460
0.01 Scale Factor Error with Delta=300 61500
Priority Target DPS
lightforged draenei Priority Target Damage Per Second
Count 1118
Mean 4527.64
Minimum 3891.95
Maximum 5354.80
Spread ( max - min ) 1462.85
Range [ ( max - min ) / 2 * 100% ] 16.15%
Standard Deviation 196.8789
5th Percentile 4209.28
95th Percentile 4850.78
( 95th Percentile - 5th Percentile ) 641.49
Mean Distribution
Standard Deviation 5.8881
95.00% Confidence Interval ( 4516.10 - 4539.19 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7264
0.1 Scale Factor Error with Delta=300 331
0.05 Scale Factor Error with Delta=300 1324
0.01 Scale Factor Error with Delta=300 33089
DPS(e)
lightforged draenei Damage Per Second (Effective)
Count 1118
Mean 8919.78
Minimum 8183.99
Maximum 9777.26
Spread ( max - min ) 1593.27
Range [ ( max - min ) / 2 * 100% ] 8.93%
Damage
lightforged draenei Damage
Count 1118
Mean 2678292.63
Minimum 1989153.82
Maximum 3259767.38
Spread ( max - min ) 1270613.56
Range [ ( max - min ) / 2 * 100% ] 23.72%
DTPS
lightforged draenei Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
lightforged draenei Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
lightforged draenei Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
lightforged draenei Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
lightforged draenei Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
lightforged draenei Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
lightforged draeneiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
lightforged draenei Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.22 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.07 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.71 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.15 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 128.10 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 49.63 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.41 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.76 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
x 2.49 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
y 3.90 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacxnowytqtssssrtsrsssptsssvstqtsssstssrsstsssrstqrtsrssstsssstnyprtqtsrssstsrssstsrssstqtsssstsssrstnptqtsrssstrssssoytsssvstqtssrsxstsssstnptqtssrsstssssrtsrsssrtqtsssrstssnptssssrtqtsssstssssrtsssstqtsssstsnoytssvsstsrsssptqtssrssrtsrssrstqts

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask lightforged draenei 69165.7/69166: 100% mana
Pre precombat U food lightforged draenei 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 shared_cds x lights_judgment Fluffy_Pillow 67790.7/69166: 98% mana
0:01.287 aoe n touch_of_the_magi Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, crimson_chorus
0:02.278 aoe o arcane_power Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, crimson_chorus
0:02.278 shared_cds w potion Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:02.278 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:02.278 aoe t arcane_barrage Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.268 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.259 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.251 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.240 aoe s arcane_explosion Fluffy_Pillow 68033.8/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.231 aoe s arcane_explosion Fluffy_Pillow 66904.7/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.221 aoe s arcane_explosion Fluffy_Pillow 65774.2/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.213 aoe r arcane_missiles Fluffy_Pillow 64646.4/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.789 aoe t arcane_barrage Fluffy_Pillow 66826.5/69166: 97% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.778 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.770 aoe r arcane_missiles Fluffy_Pillow 68038.0/69166: 98% mana bloodlust, arcane_charge, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.316 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.306 aoe s arcane_explosion Fluffy_Pillow 68035.2/69166: 98% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.298 aoe s arcane_explosion Fluffy_Pillow 66907.4/69166: 97% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.289 aoe p rune_of_power Fluffy_Pillow 65778.3/69166: 95% mana bloodlust, arcane_charge(4), crimson_chorus(2), potion_of_deathly_fixation
0:18.281 aoe t arcane_barrage Fluffy_Pillow 67150.6/69166: 97% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.270 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.262 aoe s arcane_explosion Fluffy_Pillow 65538.0/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.252 aoe s arcane_explosion Fluffy_Pillow 61907.4/69166: 90% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.241 shared_cds v use_mana_gem lightforged draenei 58275.5/69166: 84% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.241 aoe s arcane_explosion Fluffy_Pillow 65192.1/69166: 94% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.231 aoe t arcane_barrage Fluffy_Pillow 61561.6/69166: 89% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.222 aoe q arcane_orb Fluffy_Pillow 65699.1/69166: 95% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.211 aoe t arcane_barrage Fluffy_Pillow 66567.2/69166: 96% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.201 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.192 aoe s arcane_explosion Fluffy_Pillow 65536.6/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:28.182 aoe s arcane_explosion Fluffy_Pillow 61906.1/69166: 90% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3)
0:29.173 aoe s arcane_explosion Fluffy_Pillow 58276.9/69166: 84% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3)
0:30.163 aoe t arcane_barrage Fluffy_Pillow 54646.4/69166: 79% mana bloodlust, arcane_charge(4), rune_of_power
0:31.154 aoe s arcane_explosion Fluffy_Pillow 58783.9/69166: 85% mana bloodlust
0:32.144 aoe s arcane_explosion Fluffy_Pillow 55153.4/69166: 80% mana bloodlust, arcane_charge
0:33.135 aoe r arcane_missiles Fluffy_Pillow 51524.2/69166: 74% mana bloodlust, arcane_charge(2), clearcasting
0:34.785 aoe s arcane_explosion Fluffy_Pillow 53806.7/69166: 78% mana bloodlust, arcane_charge(2)
0:35.777 aoe s arcane_explosion Fluffy_Pillow 50179.0/69166: 73% mana bloodlust, arcane_charge(3)
0:36.768 aoe t arcane_barrage Fluffy_Pillow 46549.8/69166: 67% mana bloodlust, arcane_charge(4)
0:37.758 aoe s arcane_explosion Fluffy_Pillow 50685.9/69166: 73% mana bloodlust
0:38.750 aoe s arcane_explosion Fluffy_Pillow 47058.2/69166: 68% mana bloodlust, arcane_charge
0:39.741 aoe s arcane_explosion Fluffy_Pillow 43429.0/69166: 63% mana bloodlust, arcane_charge(2)
0:40.731 aoe r arcane_missiles Fluffy_Pillow 39798.5/69166: 58% mana bloodlust, arcane_charge(3), clearcasting
0:42.251 aoe s arcane_explosion Fluffy_Pillow 41901.2/69166: 61% mana arcane_charge(3)
0:43.538 aoe t arcane_barrage Fluffy_Pillow 38681.5/69166: 56% mana arcane_charge(4)
0:44.826 aoe q arcane_orb Fluffy_Pillow 43229.8/69166: 63% mana
0:46.114 aoe r arcane_missiles Fluffy_Pillow 44511.5/69166: 64% mana arcane_charge(4), clearcasting
0:48.014 aoe t arcane_barrage Fluffy_Pillow 47139.8/69166: 68% mana arcane_charge(4)
0:49.299 aoe s arcane_explosion Fluffy_Pillow 51684.0/69166: 75% mana
0:50.585 aoe r arcane_missiles Fluffy_Pillow 48463.0/69166: 70% mana arcane_charge, clearcasting
0:52.581 aoe s arcane_explosion Fluffy_Pillow 51224.1/69166: 74% mana arcane_charge
0:53.866 aoe s arcane_explosion Fluffy_Pillow 48001.6/69166: 69% mana arcane_charge(2)
0:55.153 aoe s arcane_explosion Fluffy_Pillow 44781.9/69166: 65% mana arcane_charge(3)
0:56.439 aoe t arcane_barrage Fluffy_Pillow 41560.9/69166: 60% mana arcane_charge(4)
0:57.726 aoe s arcane_explosion Fluffy_Pillow 46107.8/69166: 67% mana
0:59.012 aoe s arcane_explosion Fluffy_Pillow 42886.8/69166: 62% mana arcane_charge
1:00.299 aoe s arcane_explosion Fluffy_Pillow 39667.1/69166: 57% mana arcane_charge(2)
1:01.585 aoe s arcane_explosion Fluffy_Pillow 36446.0/69166: 53% mana arcane_charge(3), crimson_chorus
1:02.871 aoe t arcane_barrage Fluffy_Pillow 33225.0/69166: 48% mana arcane_charge(4), crimson_chorus
1:04.156 aoe n touch_of_the_magi Fluffy_Pillow 37769.2/69166: 55% mana crimson_chorus
1:05.442 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 37048.1/69166: 54% mana arcane_charge(4), clearcasting, crimson_chorus
1:05.442 aoe p rune_of_power Fluffy_Pillow 37048.1/69166: 54% mana arcane_charge(4), clearcasting, crimson_chorus, gladiators_badge
1:06.732 aoe r arcane_missiles Fluffy_Pillow 38832.6/69166: 56% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus, gladiators_badge
1:08.694 aoe t arcane_barrage Fluffy_Pillow 41546.7/69166: 60% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:09.981 aoe q arcane_orb Fluffy_Pillow 46093.6/69166: 67% mana rune_of_power, crimson_chorus, gladiators_badge
1:11.268 aoe t arcane_barrage Fluffy_Pillow 47373.9/69166: 68% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
1:12.555 aoe s arcane_explosion Fluffy_Pillow 51920.9/69166: 75% mana rune_of_power, crimson_chorus(2), gladiators_badge
1:13.841 aoe r arcane_missiles Fluffy_Pillow 48699.8/69166: 70% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
1:15.959 aoe s arcane_explosion Fluffy_Pillow 51629.7/69166: 75% mana arcane_charge, rune_of_power, crimson_chorus(2), gladiators_badge
1:17.246 aoe s arcane_explosion Fluffy_Pillow 48410.0/69166: 70% mana arcane_charge(2), rune_of_power, crimson_chorus(2), gladiators_badge
1:18.532 aoe s arcane_explosion Fluffy_Pillow 45189.0/69166: 65% mana arcane_charge(3), rune_of_power, crimson_chorus(2), gladiators_badge
1:19.818 aoe t arcane_barrage Fluffy_Pillow 41967.9/69166: 61% mana arcane_charge(4), crimson_chorus(2), gladiators_badge
1:21.104 aoe s arcane_explosion Fluffy_Pillow 46513.5/69166: 67% mana crimson_chorus(3)
1:22.390 aoe r arcane_missiles Fluffy_Pillow 43292.4/69166: 63% mana arcane_charge, clearcasting, crimson_chorus(3)
1:24.253 aoe s arcane_explosion Fluffy_Pillow 45869.5/69166: 66% mana arcane_charge, crimson_chorus(3)
1:25.540 aoe s arcane_explosion Fluffy_Pillow 42649.9/69166: 62% mana arcane_charge(2), crimson_chorus(3)
1:26.824 aoe s arcane_explosion Fluffy_Pillow 39426.0/69166: 57% mana arcane_charge(3), crimson_chorus(3)
1:28.113 aoe t arcane_barrage Fluffy_Pillow 36209.1/69166: 52% mana arcane_charge(4), crimson_chorus(3)
1:29.401 aoe s arcane_explosion Fluffy_Pillow 40757.5/69166: 59% mana crimson_chorus(3)
1:30.687 aoe r arcane_missiles Fluffy_Pillow 37536.4/69166: 54% mana arcane_charge, clearcasting
1:32.770 aoe s arcane_explosion Fluffy_Pillow 40417.8/69166: 58% mana arcane_charge
1:34.053 aoe s arcane_explosion Fluffy_Pillow 37192.6/69166: 54% mana arcane_charge(2)
1:35.341 aoe s arcane_explosion Fluffy_Pillow 33974.3/69166: 49% mana arcane_charge(3)
1:36.627 aoe t arcane_barrage Fluffy_Pillow 30753.3/69166: 44% mana arcane_charge(4)
1:37.915 aoe q arcane_orb Fluffy_Pillow 35301.6/69166: 51% mana
1:39.202 aoe t arcane_barrage Fluffy_Pillow 36582.0/69166: 53% mana arcane_charge(4)
1:40.488 aoe s arcane_explosion Fluffy_Pillow 41127.5/69166: 59% mana
1:41.775 aoe s arcane_explosion Fluffy_Pillow 37907.9/69166: 55% mana arcane_charge
1:43.063 aoe s arcane_explosion Fluffy_Pillow 34689.6/69166: 50% mana arcane_charge(2)
1:44.348 aoe s arcane_explosion Fluffy_Pillow 31467.1/69166: 45% mana arcane_charge(3)
1:45.634 aoe t arcane_barrage Fluffy_Pillow 28246.1/69166: 41% mana arcane_charge(4)
1:46.921 aoe s arcane_explosion Fluffy_Pillow 32793.0/69166: 47% mana
1:48.209 aoe s arcane_explosion Fluffy_Pillow 29574.7/69166: 43% mana arcane_charge
1:49.495 aoe s arcane_explosion Fluffy_Pillow 26353.7/69166: 38% mana arcane_charge(2)
1:50.781 aoe r arcane_missiles Fluffy_Pillow 23132.6/69166: 33% mana arcane_charge(3), clearcasting
1:52.749 aoe s arcane_explosion Fluffy_Pillow 25855.0/69166: 37% mana arcane_charge(3)
1:54.034 aoe t arcane_barrage Fluffy_Pillow 22632.5/69166: 33% mana arcane_charge(4)
1:55.319 aoe n touch_of_the_magi Fluffy_Pillow 27176.7/69166: 39% mana
1:56.605 aoe p rune_of_power Fluffy_Pillow 26455.7/69166: 38% mana arcane_charge(4)
1:57.893 aoe t arcane_barrage Fluffy_Pillow 28237.4/69166: 41% mana arcane_charge(4), rune_of_power
1:59.180 aoe q arcane_orb Fluffy_Pillow 32784.3/69166: 47% mana rune_of_power
2:00.466 aoe t arcane_barrage Fluffy_Pillow 34063.3/69166: 49% mana arcane_charge(4), rune_of_power
2:01.752 aoe s arcane_explosion Fluffy_Pillow 38608.8/69166: 56% mana rune_of_power, crimson_chorus
2:03.039 aoe r arcane_missiles Fluffy_Pillow 35389.2/69166: 51% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus
2:04.985 aoe s arcane_explosion Fluffy_Pillow 38081.1/69166: 55% mana arcane_charge, rune_of_power, crimson_chorus
2:06.272 aoe s arcane_explosion Fluffy_Pillow 34861.4/69166: 50% mana arcane_charge(2), rune_of_power, crimson_chorus
2:07.559 aoe s arcane_explosion Fluffy_Pillow 31641.7/69166: 46% mana arcane_charge(3), rune_of_power, crimson_chorus
2:08.846 aoe t arcane_barrage Fluffy_Pillow 28422.1/69166: 41% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
2:10.133 aoe r arcane_missiles Fluffy_Pillow 32969.0/69166: 48% mana clearcasting, crimson_chorus
2:12.093 aoe s arcane_explosion Fluffy_Pillow 35680.3/69166: 52% mana crimson_chorus(2)
2:13.380 aoe s arcane_explosion Fluffy_Pillow 32460.6/69166: 47% mana arcane_charge, crimson_chorus(2)
2:14.668 aoe s arcane_explosion Fluffy_Pillow 29242.4/69166: 42% mana arcane_charge(2), crimson_chorus(2)
2:15.955 aoe s arcane_explosion Fluffy_Pillow 26022.7/69166: 38% mana arcane_charge(3), crimson_chorus(2)
2:17.241 aoe o arcane_power Fluffy_Pillow 22801.6/69166: 33% mana arcane_charge(4), crimson_chorus(2)
2:17.241 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 22801.6/69166: 33% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
2:17.241 aoe t arcane_barrage Fluffy_Pillow 22801.6/69166: 33% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.529 aoe s arcane_explosion Fluffy_Pillow 27350.0/69166: 40% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.817 aoe s arcane_explosion Fluffy_Pillow 26631.7/69166: 39% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:21.104 aoe s arcane_explosion Fluffy_Pillow 25912.0/69166: 37% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:22.392 shared_cds v use_mana_gem lightforged draenei 25193.7/69166: 36% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:22.392 aoe s arcane_explosion Fluffy_Pillow 32110.3/69166: 46% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:23.678 aoe t arcane_barrage Fluffy_Pillow 31389.2/69166: 45% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:24.964 aoe q arcane_orb Fluffy_Pillow 35934.8/69166: 52% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:26.252 aoe t arcane_barrage Fluffy_Pillow 37466.5/69166: 54% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:27.539 aoe s arcane_explosion Fluffy_Pillow 42013.4/69166: 61% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:28.826 aoe s arcane_explosion Fluffy_Pillow 41293.8/69166: 60% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:30.113 aoe r arcane_missiles Fluffy_Pillow 40574.1/69166: 59% mana arcane_charge(2), arcane_power, clearcasting, crimson_chorus(3), gladiators_badge
2:32.067 aoe s arcane_explosion Fluffy_Pillow 43277.1/69166: 63% mana arcane_charge(2), arcane_power, gladiators_badge
2:33.352 shared_cds x lights_judgment Fluffy_Pillow 42554.7/69166: 62% mana arcane_charge(3)
2:34.637 aoe s arcane_explosion Fluffy_Pillow 44332.2/69166: 64% mana arcane_charge(3)
2:35.925 aoe t arcane_barrage Fluffy_Pillow 41113.9/69166: 59% mana arcane_charge(4)
2:37.211 aoe s arcane_explosion Fluffy_Pillow 45659.5/69166: 66% mana
2:38.499 aoe s arcane_explosion Fluffy_Pillow 42441.2/69166: 61% mana arcane_charge
2:39.784 aoe s arcane_explosion Fluffy_Pillow 39218.8/69166: 57% mana arcane_charge(2)
2:41.070 aoe s arcane_explosion Fluffy_Pillow 35997.7/69166: 52% mana arcane_charge(3)
2:42.356 aoe t arcane_barrage Fluffy_Pillow 32776.6/69166: 47% mana arcane_charge(4)
2:43.643 aoe n touch_of_the_magi Fluffy_Pillow 37323.6/69166: 54% mana
2:44.929 aoe p rune_of_power Fluffy_Pillow 36602.5/69166: 53% mana arcane_charge(4)
2:46.214 aoe t arcane_barrage Fluffy_Pillow 38380.1/69166: 55% mana arcane_charge(4), rune_of_power
2:47.500 aoe q arcane_orb Fluffy_Pillow 42925.7/69166: 62% mana rune_of_power
2:48.788 aoe t arcane_barrage Fluffy_Pillow 44207.4/69166: 64% mana arcane_charge(4), rune_of_power
2:50.075 aoe s arcane_explosion Fluffy_Pillow 48754.3/69166: 70% mana rune_of_power
2:51.363 aoe s arcane_explosion Fluffy_Pillow 45536.0/69166: 66% mana arcane_charge, rune_of_power
2:52.649 aoe r arcane_missiles Fluffy_Pillow 42315.0/69166: 61% mana arcane_charge(2), clearcasting, rune_of_power
2:54.508 aoe s arcane_explosion Fluffy_Pillow 44886.6/69166: 65% mana arcane_charge(2), rune_of_power
2:55.795 aoe s arcane_explosion Fluffy_Pillow 41666.9/69166: 60% mana arcane_charge(3), rune_of_power
2:57.083 aoe t arcane_barrage Fluffy_Pillow 38448.6/69166: 56% mana arcane_charge(4), rune_of_power
2:58.370 aoe s arcane_explosion Fluffy_Pillow 42995.6/69166: 62% mana
2:59.658 aoe s arcane_explosion Fluffy_Pillow 39777.3/69166: 58% mana arcane_charge
3:00.945 aoe s arcane_explosion Fluffy_Pillow 36557.6/69166: 53% mana arcane_charge(2)
3:02.230 aoe s arcane_explosion Fluffy_Pillow 33335.1/69166: 48% mana arcane_charge(3), crimson_chorus
3:03.516 aoe r arcane_missiles Fluffy_Pillow 30114.1/69166: 44% mana arcane_charge(4), clearcasting, crimson_chorus
3:05.543 aoe t arcane_barrage Fluffy_Pillow 32918.1/69166: 48% mana arcane_charge(4), crimson_chorus
3:06.828 aoe s arcane_explosion Fluffy_Pillow 37462.3/69166: 54% mana crimson_chorus
3:08.115 aoe r arcane_missiles Fluffy_Pillow 34242.6/69166: 50% mana arcane_charge, clearcasting, crimson_chorus
3:10.027 aoe s arcane_explosion Fluffy_Pillow 36887.5/69166: 53% mana arcane_charge, crimson_chorus
3:11.313 aoe s arcane_explosion Fluffy_Pillow 33666.4/69166: 49% mana arcane_charge(2), crimson_chorus(2)
3:12.598 aoe s arcane_explosion Fluffy_Pillow 30444.0/69166: 44% mana arcane_charge(3), crimson_chorus(2)
3:13.885 aoe r arcane_missiles Fluffy_Pillow 27224.3/69166: 39% mana arcane_charge(4), clearcasting, crimson_chorus(2)
3:15.938 aoe t arcane_barrage Fluffy_Pillow 30064.2/69166: 43% mana arcane_charge(4), crimson_chorus(2)
3:17.224 aoe q arcane_orb Fluffy_Pillow 34609.8/69166: 50% mana crimson_chorus(2)
3:18.511 aoe t arcane_barrage Fluffy_Pillow 35890.1/69166: 52% mana arcane_charge(4), crimson_chorus(2)
3:19.798 aoe s arcane_explosion Fluffy_Pillow 40437.1/69166: 58% mana crimson_chorus(2)
3:21.084 aoe s arcane_explosion Fluffy_Pillow 37216.0/69166: 54% mana arcane_charge, crimson_chorus(3)
3:22.370 aoe s arcane_explosion Fluffy_Pillow 33995.0/69166: 49% mana arcane_charge(2), crimson_chorus(3)
3:23.657 aoe r arcane_missiles Fluffy_Pillow 30775.3/69166: 44% mana arcane_charge(3), clearcasting, crimson_chorus(3)
3:25.601 aoe s arcane_explosion Fluffy_Pillow 33464.5/69166: 48% mana arcane_charge(3), crimson_chorus(3)
3:26.886 aoe t arcane_barrage Fluffy_Pillow 30242.0/69166: 44% mana arcane_charge(4), crimson_chorus(3)
3:28.172 aoe s arcane_explosion Fluffy_Pillow 34787.6/69166: 50% mana crimson_chorus(3)
3:29.458 aoe s arcane_explosion Fluffy_Pillow 31566.5/69166: 46% mana arcane_charge, crimson_chorus(3)
3:30.743 aoe n touch_of_the_magi Fluffy_Pillow 28344.1/69166: 41% mana arcane_charge(2), crimson_chorus(3)
3:32.029 aoe p rune_of_power Fluffy_Pillow 27623.0/69166: 40% mana arcane_charge(4)
3:33.315 aoe t arcane_barrage Fluffy_Pillow 29402.0/69166: 43% mana arcane_charge(4), rune_of_power
3:34.599 aoe s arcane_explosion Fluffy_Pillow 33944.8/69166: 49% mana rune_of_power
3:35.886 aoe s arcane_explosion Fluffy_Pillow 30725.1/69166: 44% mana arcane_charge, rune_of_power
3:37.171 aoe s arcane_explosion Fluffy_Pillow 27502.7/69166: 40% mana arcane_charge(2), rune_of_power
3:38.460 aoe s arcane_explosion Fluffy_Pillow 24285.8/69166: 35% mana arcane_charge(3), rune_of_power
3:39.748 aoe r arcane_missiles Fluffy_Pillow 21067.5/69166: 30% mana arcane_charge(4), clearcasting, rune_of_power
3:41.632 aoe t arcane_barrage Fluffy_Pillow 23673.6/69166: 34% mana arcane_charge(4), rune_of_power
3:42.918 aoe q arcane_orb Fluffy_Pillow 28219.2/69166: 41% mana rune_of_power
3:44.205 aoe t arcane_barrage Fluffy_Pillow 29499.5/69166: 43% mana arcane_charge(4), rune_of_power
3:45.492 aoe s arcane_explosion Fluffy_Pillow 34046.5/69166: 49% mana
3:46.779 aoe s arcane_explosion Fluffy_Pillow 30826.8/69166: 45% mana arcane_charge
3:48.065 aoe s arcane_explosion Fluffy_Pillow 27605.8/69166: 40% mana arcane_charge(2)
3:49.351 aoe s arcane_explosion Fluffy_Pillow 24384.7/69166: 35% mana arcane_charge(3)
3:50.638 aoe t arcane_barrage Fluffy_Pillow 21165.0/69166: 31% mana arcane_charge(4)
3:51.924 aoe s arcane_explosion Fluffy_Pillow 25710.6/69166: 37% mana
3:53.210 aoe s arcane_explosion Fluffy_Pillow 22489.5/69166: 33% mana arcane_charge
3:54.496 aoe s arcane_explosion Fluffy_Pillow 19268.5/69166: 28% mana arcane_charge(2)
3:55.781 aoe s arcane_explosion Fluffy_Pillow 16046.0/69166: 23% mana arcane_charge(3)
3:57.067 aoe r arcane_missiles Fluffy_Pillow 12825.0/69166: 19% mana arcane_charge(4), clearcasting
3:58.918 aoe t arcane_barrage Fluffy_Pillow 15385.5/69166: 22% mana arcane_charge(4)
4:00.206 aoe s arcane_explosion Fluffy_Pillow 19933.8/69166: 29% mana
4:01.493 aoe s arcane_explosion Fluffy_Pillow 16714.2/69166: 24% mana arcane_charge
4:02.780 aoe s arcane_explosion Fluffy_Pillow 13494.5/69166: 20% mana arcane_charge(2), crimson_chorus
4:04.069 aoe s arcane_explosion Fluffy_Pillow 10277.6/69166: 15% mana arcane_charge(3), crimson_chorus
4:05.355 aoe t arcane_barrage Fluffy_Pillow 7056.5/69166: 10% mana arcane_charge(4), crimson_chorus
4:06.643 aoe q arcane_orb Fluffy_Pillow 11604.9/69166: 17% mana crimson_chorus
4:07.930 aoe t arcane_barrage Fluffy_Pillow 12885.2/69166: 19% mana arcane_charge(4), crimson_chorus
4:09.217 aoe s arcane_explosion Fluffy_Pillow 17432.1/69166: 25% mana crimson_chorus
4:10.503 aoe s arcane_explosion Fluffy_Pillow 14211.1/69166: 21% mana arcane_charge, crimson_chorus
4:11.788 aoe s arcane_explosion Fluffy_Pillow 10988.6/69166: 16% mana arcane_charge(2), crimson_chorus(2)
4:13.074 aoe s arcane_explosion Fluffy_Pillow 7767.6/69166: 11% mana arcane_charge(3), crimson_chorus(2)
4:14.360 aoe t arcane_barrage Fluffy_Pillow 4546.5/69166: 7% mana arcane_charge(4), crimson_chorus(2)
4:15.647 aoe s arcane_explosion Fluffy_Pillow 9093.5/69166: 13% mana crimson_chorus(2)
4:16.933 aoe n touch_of_the_magi Fluffy_Pillow 5872.4/69166: 8% mana arcane_charge, crimson_chorus(2)
4:18.312 aoe o arcane_power Fluffy_Pillow 5280.0/69166: 8% mana arcane_charge(4), crimson_chorus(2)
4:18.312 shared_cds y use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 5280.0/69166: 8% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:18.312 aoe t arcane_barrage Fluffy_Pillow 5280.0/69166: 8% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.600 aoe s arcane_explosion Fluffy_Pillow 9828.3/69166: 14% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.887 aoe s arcane_explosion Fluffy_Pillow 9108.7/69166: 13% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.174 shared_cds v use_mana_gem lightforged draenei 8389.0/69166: 12% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:22.392 aoe s arcane_explosion Fluffy_Pillow 15607.1/69166: 23% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:23.678 aoe s arcane_explosion Fluffy_Pillow 14886.1/69166: 22% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:24.964 aoe t arcane_barrage Fluffy_Pillow 14165.0/69166: 20% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.250 aoe s arcane_explosion Fluffy_Pillow 18710.6/69166: 27% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.538 aoe r arcane_missiles Fluffy_Pillow 17992.3/69166: 26% mana arcane_charge, arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
4:29.538 aoe s arcane_explosion Fluffy_Pillow 20758.9/69166: 30% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:30.824 aoe s arcane_explosion Fluffy_Pillow 20037.9/69166: 29% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
4:32.111 aoe s arcane_explosion Fluffy_Pillow 19318.2/69166: 28% mana arcane_charge(3), arcane_power, gladiators_badge
4:33.398 aoe p rune_of_power Fluffy_Pillow 18598.5/69166: 27% mana arcane_charge(4)
4:34.686 aoe t arcane_barrage Fluffy_Pillow 20380.2/69166: 29% mana arcane_charge(4), rune_of_power
4:35.973 aoe q arcane_orb Fluffy_Pillow 24927.2/69166: 36% mana rune_of_power
4:37.259 aoe t arcane_barrage Fluffy_Pillow 26206.1/69166: 38% mana arcane_charge(4), rune_of_power
4:38.545 aoe s arcane_explosion Fluffy_Pillow 30751.7/69166: 44% mana rune_of_power
4:39.830 aoe s arcane_explosion Fluffy_Pillow 27529.2/69166: 40% mana arcane_charge, rune_of_power
4:41.116 aoe r arcane_missiles Fluffy_Pillow 24308.2/69166: 35% mana arcane_charge(2), clearcasting, rune_of_power
4:43.047 aoe s arcane_explosion Fluffy_Pillow 26979.4/69166: 39% mana arcane_charge(2), rune_of_power
4:44.332 aoe s arcane_explosion Fluffy_Pillow 23756.9/69166: 34% mana arcane_charge(3), rune_of_power
4:45.620 aoe r arcane_missiles Fluffy_Pillow 20538.6/69166: 30% mana arcane_charge(4), clearcasting, rune_of_power
4:47.572 aoe t arcane_barrage Fluffy_Pillow 23238.9/69166: 34% mana arcane_charge(4)
4:48.858 aoe s arcane_explosion Fluffy_Pillow 27784.4/69166: 40% mana
4:50.144 aoe r arcane_missiles Fluffy_Pillow 24563.4/69166: 36% mana arcane_charge, clearcasting
4:52.183 aoe s arcane_explosion Fluffy_Pillow 27384.0/69166: 40% mana arcane_charge
4:53.469 aoe s arcane_explosion Fluffy_Pillow 24162.9/69166: 35% mana arcane_charge(2)
4:54.755 aoe r arcane_missiles Fluffy_Pillow 20941.8/69166: 30% mana arcane_charge(3), clearcasting
4:56.731 aoe s arcane_explosion Fluffy_Pillow 23675.3/69166: 34% mana arcane_charge(3)
4:58.018 aoe t arcane_barrage Fluffy_Pillow 20455.6/69166: 30% mana arcane_charge(4)
4:59.305 aoe q arcane_orb Fluffy_Pillow 25002.6/69166: 36% mana
5:00.590 aoe t arcane_barrage Fluffy_Pillow 26280.1/69166: 38% mana arcane_charge(4)
5:01.877 aoe s arcane_explosion Fluffy_Pillow 30827.1/69166: 45% mana

Stats

Level Bonus (60) Race Bonus (lightforged_draenei) Raid-Buffed Unbuffed Gear Amount
Strength 198 0 198 198 0
Agility 306 -1 305 305 0
Stamina 414 1 2028 1932 1517
Intellect 450 0 1795 1615 1089 (46)
Spirit 0 0 0 0 0
Health 40560 38640 0
Mana 69166 69166 0
Spell Power 1795 1615 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="lightforged draenei"
source=default
spec=arcane
level=60
race=lightforged_draenei
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

mechagnome : 8985 dps, 4601 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8985.4 8985.4 15.4 / 0.172% 1035.5 / 11.5% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2041.4 1936.3 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
mechagnome 8985
Arcane Barrage 3791 42.2% 50.0 6.05sec 22822 18451 Direct 149.8 6439 13274 7619 17.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 49.99 149.77 0.00 0.00 1.2369 0.0000 1140781.82 1140781.82 0.00% 18451.19 18451.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.74% 123.92 87 167 6438.68 2206 31409 6430.87 5642 7275 797591 797591 0.00%
crit 17.26% 25.86 11 44 13273.78 4412 62818 13245.47 7830 20393 343191 343191 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:49.99
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 912 1823 1043 14.6%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1044.41 1044.41 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.42% 0.85 0 1 911.52 912 912 778.62 0 912 779 779 0.00%
crit 14.58% 0.15 0 1 1823.03 1823 1823 265.79 0 1823 266 266 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2957 32.9% 129.4 2.30sec 6868 5568 Direct 388.1 1940 3972 2290 17.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.37 388.10 0.00 0.00 1.2334 0.0000 888539.88 888539.88 0.00% 5568.44 5568.44
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.81% 321.40 232 424 1940.38 1467 3651 1940.92 1822 2082 623585 623585 0.00%
crit 17.19% 66.70 36 104 3972.29 2934 7302 3972.09 3372 4585 264955 264955 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.38
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1028 11.4% 24.5 11.68sec 12592 6629 Periodic 195.6 1343 2732 1580 17.1% 4.5%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.54 0.00 195.76 195.63 1.8995 0.2065 309015.29 309015.29 0.00% 6629.10 6629.10
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.95% 162.27 55 271 1342.98 1075 2676 1341.95 1116 1637 217907 217907 0.00%
crit 17.05% 33.36 7 60 2731.52 2151 5352 2725.66 2214 3541 91108 91108 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.52
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (602) 0.0% (6.7%) 12.7 24.44sec 14251 11494

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.70 0.00 0.00 0.00 1.2399 0.0000 0.00 0.00 0.00% 11493.93 11493.93

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.70
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 602 6.7% 38.1 24.44sec 4756 0 Direct 38.1 4037 8193 4757 17.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.06 38.06 0.00 0.00 0.0000 0.0000 181006.43 181006.43 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.67% 31.46 21 44 4037.03 2914 7215 4034.16 3288 4707 126962 126962 0.00%
crit 17.33% 6.60 0 16 8193.41 5828 14431 8196.92 0 13614 54044 54044 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 13.9 1.82sec 514 0 Periodic 40.6 (42.5) 112 0 112 0.0% (0.0%) 4.4%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.86 0.00 40.62 40.62 0.0000 0.9868 4546.41 4546.41 0.00% 177.74 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.62 13 63 111.94 0 202 112.11 67 166 4546 4546 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 9.27sec 1339 0 Direct 1.9 1115 2227 1336 20.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.93 1.93 0.00 0.00 0.0000 0.0000 2577.90 2577.90 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.93% 1.54 0 4 1115.42 1093 1158 1043.78 0 1158 1717 1717 0.00%
crit 20.07% 0.39 0 3 2227.06 2185 2316 765.58 0 2316 861 861 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.3 14.46sec 529 0 Direct 20.3 452 905 529 17.0%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.26 20.26 0.00 0.00 0.0000 0.0000 10717.03 10717.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.01% 16.82 6 32 452.16 444 470 452.18 444 463 7604 7604 0.00%
crit 16.99% 3.44 0 10 904.58 887 941 874.03 0 941 3113 3113 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4131 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 103  / 14 0.2% 90.0 1.31sec 46 35 Direct 90.0 39 78 46 18.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4131.00 4131.00 0.00% 34.59 34.59
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.74% 73.57 60 83 38.65 30 46 38.65 38 40 2843 2843 0.00%
crit 18.26% 16.43 7 30 78.36 60 92 78.39 68 88 1288 1288 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (531) 0.0% (5.9%) 6.2 52.04sec 25705 19981

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19981.02 19981.02

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 531 5.9% 6.2 51.90sec 25705 0 Direct 18.6 8599 0 8599 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.57 0.00 0.00 0.0000 0.0000 159588.39 159588.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.57 12 21 8599.36 243 40754 8585.19 5609 12503 159588 159588 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5510.06
  • base_dd_max:5510.06
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
mechagnome
Arcane Power 2.9 127.10sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.88
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.49 0.00 2.89 0.00 4.2103 0.7099 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mechagnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.49
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mechagnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mechagnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.20sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2376 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.08
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 122.95sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mechagnome
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.76
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.8 136.6 6.0sec 1.6sec 4.6sec 78.05% 0.00% 3.0 (4.0) 0.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 17.8s
  • trigger_min/max:0.0s / 8.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.4s

Stack Uptimes

  • arcane_charge_1:20.66%
  • arcane_charge_2:17.70%
  • arcane_charge_3:16.86%
  • arcane_charge_4:22.83%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.2sec 127.2sec 14.7sec 14.04% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 140.3s
  • trigger_min/max:120.0s / 140.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.04%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.7 0.0 11.8sec 11.7sec 1.3sec 10.53% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.52%
  • clearcasting_2:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Combat Analysis 1.0 58.6 0.0sec 5.0sec 295.8sec 98.31% 0.00% 50.6 (50.6) 0.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_combat_analysis
  • max_stacks:10
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:5.00

Stat Details

  • stat:intellect
  • amount:3.80

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:5.0s / 5.0s
  • trigger_pct:100.00%
  • duration_min/max:235.0s / 355.0s

Stack Uptimes

  • combat_analysis_1:1.69%
  • combat_analysis_3:1.69%
  • combat_analysis_4:1.69%
  • combat_analysis_5:1.69%
  • combat_analysis_6:1.69%
  • combat_analysis_7:1.69%
  • combat_analysis_8:1.69%
  • combat_analysis_9:1.69%
  • combat_analysis_10:84.83%

Spelldata

  • id:312923
  • name:Combat Analysis
  • tooltip:
  • description:You gather and analyze combat data every $t1 sec, increasing your primary stat by {$s1=4}, stacking up to {$s3=10} times. The data decays while out of combat.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.07% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.4s
  • trigger_min/max:60.0s / 66.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.95%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.77%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 193.3sec 193.3sec 4.2sec 0.68% 0.00% 1.9 (1.9) 0.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:148.6s / 238.0s
  • trigger_min/max:148.6s / 238.0s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 4.3s

Stack Uptimes

  • evocation_1:0.69%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 4.0 0.0 86.1sec 86.1sec 14.6sec 19.13% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 137.2s
  • trigger_min/max:60.0s / 137.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.13%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 35.02% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 61.0s
  • trigger_min/max:12.1s / 61.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.02%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.93% 0.77% 5.78% 0.9s 0.0s 4.5s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation222.51758.569354.458269.826150.030359.948
Rune of Power6.1140.00431.36338.51016.59181.108
Touch of the Magi4.8250.00025.77831.65814.27579.526
Arcane Power5.1540.00020.31614.9643.13827.198
Arcane Barrage3.5250.00314.099177.982135.513217.540
Arcane Orb4.2470.00019.42354.60030.58292.958

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
mechagnome
mana_regen Mana 1050.75 405993.29 69.70% 386.38 9495.79 2.29%
Evocation Mana 22.74 25541.53 4.39% 1123.34 0.00 0.00%
Mana Gem Mana 2.76 19066.32 3.27% 6916.57 0.00 0.00%
Arcane Barrage Mana 49.99 131869.62 22.64% 2638.00 6430.10 4.65%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1936.28 2041.38 15902.8 37553.6 13.6 69165.7
Usage Type Count Total Avg RPE APR
mechagnome
arcane_explosion Mana 129.4 591399.9 4570.9 4571.5 1.5
arcane_orb Mana 12.7 5780.6 455.1 455.1 31.3
touch_of_the_magi Mana 6.2 15512.6 2499.8 2498.6 10.3

Statistics & Data Analysis

Fight Length
mechagnome Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
mechagnome Damage Per Second
Count 1118
Mean 8985.40
Minimum 8186.54
Maximum 10001.94
Spread ( max - min ) 1815.40
Range [ ( max - min ) / 2 * 100% ] 10.10%
Standard Deviation 263.1374
5th Percentile 8563.57
95th Percentile 9416.12
( 95th Percentile - 5th Percentile ) 852.55
Mean Distribution
Standard Deviation 7.8698
95.00% Confidence Interval ( 8969.97 - 9000.82 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 33
0.1% Error 3295
0.1 Scale Factor Error with Delta=300 592
0.05 Scale Factor Error with Delta=300 2365
0.01 Scale Factor Error with Delta=300 59109
Priority Target DPS
mechagnome Priority Target Damage Per Second
Count 1118
Mean 4601.46
Minimum 3944.16
Maximum 5322.28
Spread ( max - min ) 1378.12
Range [ ( max - min ) / 2 * 100% ] 14.97%
Standard Deviation 198.7171
5th Percentile 4279.33
95th Percentile 4936.71
( 95th Percentile - 5th Percentile ) 657.37
Mean Distribution
Standard Deviation 5.9431
95.00% Confidence Interval ( 4589.81 - 4613.11 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7165
0.1 Scale Factor Error with Delta=300 338
0.05 Scale Factor Error with Delta=300 1349
0.01 Scale Factor Error with Delta=300 33710
DPS(e)
mechagnome Damage Per Second (Effective)
Count 1118
Mean 8985.40
Minimum 8186.54
Maximum 10001.94
Spread ( max - min ) 1815.40
Range [ ( max - min ) / 2 * 100% ] 10.10%
Damage
mechagnome Damage
Count 1118
Mean 2697817.56
Minimum 1965329.73
Maximum 3312186.16
Spread ( max - min ) 1346856.43
Range [ ( max - min ) / 2 * 100% ] 24.96%
DTPS
mechagnome Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
mechagnome Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
mechagnome Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
mechagnome Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
mechagnome Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
mechagnome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
mechagnomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
mechagnome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.88 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.08 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.70 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.52 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.38 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 49.99 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.49 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.76 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.95 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxtqrtssssrtssssptsrsssvrtqtsrssstsssrstsssstqtssrsstssnxptssssrtqtsssstssrsstsrssstqtssrsstnptsssstqtssssoxrtsssstsssstvqtssrssrtnptsrsrsstqtsssrstsssstssrsstqtsssstnptsrsrsstqtsssstsssstsssustqtsssstnoxtsssstsrsssptqtssssvrtsssstsssstqts

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask mechagnome 69165.7/69166: 100% mana
Pre precombat U food mechagnome 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana
0:01.283 aoe o arcane_power Fluffy_Pillow 66667.1/69166: 96% mana bloodlust, clearcasting, crimson_chorus
0:01.283 shared_cds w potion Fluffy_Pillow 66667.1/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus
0:01.283 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66667.1/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.283 aoe t arcane_barrage Fluffy_Pillow 66667.1/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.273 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.264 aoe r arcane_missiles Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.875 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.866 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, combat_analysis, potion_of_deathly_fixation, gladiators_badge
0:06.856 aoe s arcane_explosion Fluffy_Pillow 68035.2/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, combat_analysis, potion_of_deathly_fixation, gladiators_badge
0:07.848 aoe s arcane_explosion Fluffy_Pillow 66907.4/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, combat_analysis, potion_of_deathly_fixation, gladiators_badge
0:08.840 aoe s arcane_explosion Fluffy_Pillow 65779.7/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, combat_analysis, potion_of_deathly_fixation, gladiators_badge
0:09.831 aoe r arcane_missiles Fluffy_Pillow 64650.6/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, combat_analysis, potion_of_deathly_fixation, gladiators_badge
0:11.407 aoe t arcane_barrage Fluffy_Pillow 66830.7/69166: 97% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(3), potion_of_deathly_fixation, gladiators_badge
0:12.397 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(3), potion_of_deathly_fixation, gladiators_badge
0:13.388 aoe s arcane_explosion Fluffy_Pillow 68036.6/69166: 98% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), combat_analysis(3), potion_of_deathly_fixation, gladiators_badge
0:14.378 aoe s arcane_explosion Fluffy_Pillow 66906.1/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), combat_analysis(3), potion_of_deathly_fixation, gladiators_badge
0:15.368 aoe s arcane_explosion Fluffy_Pillow 65775.5/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), combat_analysis(4), potion_of_deathly_fixation, gladiators_badge
0:16.360 aoe p rune_of_power Fluffy_Pillow 64647.8/69166: 93% mana bloodlust, arcane_charge(4), crimson_chorus(2), combat_analysis(4), potion_of_deathly_fixation
0:17.349 aoe t arcane_barrage Fluffy_Pillow 66015.9/69166: 95% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(2), combat_analysis(4), potion_of_deathly_fixation
0:18.340 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(2), combat_analysis(4), potion_of_deathly_fixation
0:19.330 aoe r arcane_missiles Fluffy_Pillow 65535.2/69166: 95% mana bloodlust, arcane_charge, clearcasting, rune_of_power, crimson_chorus(2), combat_analysis(4), potion_of_deathly_fixation
0:20.926 aoe s arcane_explosion Fluffy_Pillow 67743.0/69166: 98% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), combat_analysis(5), potion_of_deathly_fixation
0:21.916 aoe s arcane_explosion Fluffy_Pillow 64112.4/69166: 93% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), combat_analysis(5), potion_of_deathly_fixation
0:22.908 aoe s arcane_explosion Fluffy_Pillow 60484.7/69166: 87% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), combat_analysis(5), potion_of_deathly_fixation
0:23.901 shared_cds v use_mana_gem mechagnome 56858.3/69166: 82% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), combat_analysis(5), potion_of_deathly_fixation
0:23.901 aoe r arcane_missiles Fluffy_Pillow 63774.9/69166: 92% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), combat_analysis(5), potion_of_deathly_fixation
0:25.429 aoe t arcane_barrage Fluffy_Pillow 65888.6/69166: 95% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), combat_analysis(6), potion_of_deathly_fixation
0:26.421 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3), combat_analysis(6)
0:27.410 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), combat_analysis(6)
0:28.399 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3), combat_analysis(6)
0:29.391 aoe r arcane_missiles Fluffy_Pillow 65538.0/69166: 95% mana bloodlust, arcane_charge, clearcasting, crimson_chorus(3), combat_analysis(6)
0:30.948 aoe s arcane_explosion Fluffy_Pillow 67691.8/69166: 98% mana bloodlust, arcane_charge, combat_analysis(7)
0:31.937 aoe s arcane_explosion Fluffy_Pillow 64059.9/69166: 93% mana bloodlust, arcane_charge(2), combat_analysis(7)
0:32.927 aoe s arcane_explosion Fluffy_Pillow 60429.4/69166: 87% mana bloodlust, arcane_charge(3), combat_analysis(7)
0:33.917 aoe t arcane_barrage Fluffy_Pillow 56798.8/69166: 82% mana bloodlust, arcane_charge(4), combat_analysis(7)
0:34.905 aoe s arcane_explosion Fluffy_Pillow 60932.2/69166: 88% mana bloodlust, combat_analysis(7)
0:35.896 aoe s arcane_explosion Fluffy_Pillow 57303.1/69166: 83% mana bloodlust, arcane_charge, combat_analysis(8)
0:36.886 aoe s arcane_explosion Fluffy_Pillow 53672.5/69166: 78% mana bloodlust, arcane_charge(2), combat_analysis(8)
0:37.877 aoe r arcane_missiles Fluffy_Pillow 50043.4/69166: 72% mana bloodlust, arcane_charge(3), clearcasting, combat_analysis(8)
0:39.419 aoe s arcane_explosion Fluffy_Pillow 52176.5/69166: 75% mana bloodlust, arcane_charge(3), combat_analysis(8)
0:40.411 aoe t arcane_barrage Fluffy_Pillow 48548.7/69166: 70% mana bloodlust, arcane_charge(4), combat_analysis(9)
0:41.402 aoe s arcane_explosion Fluffy_Pillow 52686.2/69166: 76% mana combat_analysis(9)
0:42.690 aoe s arcane_explosion Fluffy_Pillow 49467.9/69166: 72% mana arcane_charge, combat_analysis(9)
0:43.978 aoe s arcane_explosion Fluffy_Pillow 46249.6/69166: 67% mana arcane_charge(2), combat_analysis(9)
0:45.265 aoe s arcane_explosion Fluffy_Pillow 43030.0/69166: 62% mana arcane_charge(3), combat_analysis(10)
0:46.551 aoe t arcane_barrage Fluffy_Pillow 39808.9/69166: 58% mana arcane_charge(4), combat_analysis(10)
0:47.837 aoe q arcane_orb Fluffy_Pillow 44354.5/69166: 64% mana combat_analysis(10)
0:49.122 aoe t arcane_barrage Fluffy_Pillow 45632.0/69166: 66% mana arcane_charge(4), combat_analysis(10)
0:50.409 aoe s arcane_explosion Fluffy_Pillow 50179.0/69166: 73% mana combat_analysis(10)
0:51.696 aoe s arcane_explosion Fluffy_Pillow 46959.3/69166: 68% mana arcane_charge, combat_analysis(10)
0:52.982 aoe r arcane_missiles Fluffy_Pillow 43738.2/69166: 63% mana arcane_charge(2), clearcasting, combat_analysis(10)
0:54.937 aoe s arcane_explosion Fluffy_Pillow 46442.6/69166: 67% mana arcane_charge(2), combat_analysis(10)
0:56.224 aoe s arcane_explosion Fluffy_Pillow 43222.9/69166: 62% mana arcane_charge(3), combat_analysis(10)
0:57.511 aoe t arcane_barrage Fluffy_Pillow 40003.3/69166: 58% mana arcane_charge(4), combat_analysis(10)
0:58.797 aoe s arcane_explosion Fluffy_Pillow 44548.8/69166: 64% mana combat_analysis(10)
1:00.084 aoe s arcane_explosion Fluffy_Pillow 41329.2/69166: 60% mana arcane_charge, combat_analysis(10)
1:01.370 aoe n touch_of_the_magi Fluffy_Pillow 38108.1/69166: 55% mana arcane_charge(2), crimson_chorus, combat_analysis(10)
1:02.656 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 37387.1/69166: 54% mana arcane_charge(4), crimson_chorus, combat_analysis(10)
1:02.656 aoe p rune_of_power Fluffy_Pillow 37387.1/69166: 54% mana arcane_charge(4), crimson_chorus, combat_analysis(10), gladiators_badge
1:03.940 aoe t arcane_barrage Fluffy_Pillow 39163.2/69166: 57% mana arcane_charge(4), rune_of_power, crimson_chorus, combat_analysis(10), gladiators_badge
1:05.227 aoe s arcane_explosion Fluffy_Pillow 43710.2/69166: 63% mana rune_of_power, crimson_chorus, combat_analysis(10), gladiators_badge
1:06.513 aoe s arcane_explosion Fluffy_Pillow 40489.1/69166: 59% mana arcane_charge, rune_of_power, crimson_chorus, combat_analysis(10), gladiators_badge
1:07.798 aoe s arcane_explosion Fluffy_Pillow 37266.7/69166: 54% mana arcane_charge(2), rune_of_power, crimson_chorus, combat_analysis(10), gladiators_badge
1:09.086 aoe s arcane_explosion Fluffy_Pillow 34048.4/69166: 49% mana arcane_charge(3), rune_of_power, crimson_chorus, combat_analysis(10), gladiators_badge
1:10.373 aoe r arcane_missiles Fluffy_Pillow 30828.7/69166: 45% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
1:12.279 aoe t arcane_barrage Fluffy_Pillow 33465.3/69166: 48% mana arcane_charge(4), rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
1:13.566 aoe q arcane_orb Fluffy_Pillow 38012.3/69166: 55% mana rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
1:14.852 aoe t arcane_barrage Fluffy_Pillow 39291.2/69166: 57% mana arcane_charge(4), rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
1:16.139 aoe s arcane_explosion Fluffy_Pillow 43838.2/69166: 63% mana crimson_chorus(2), combat_analysis(10), gladiators_badge
1:17.426 aoe s arcane_explosion Fluffy_Pillow 40618.5/69166: 59% mana arcane_charge, crimson_chorus(2), combat_analysis(10), gladiators_badge
1:18.713 aoe s arcane_explosion Fluffy_Pillow 37398.8/69166: 54% mana arcane_charge(2), crimson_chorus(2), combat_analysis(10)
1:20.000 aoe s arcane_explosion Fluffy_Pillow 34179.1/69166: 49% mana arcane_charge(3), crimson_chorus(2), combat_analysis(10)
1:21.286 aoe t arcane_barrage Fluffy_Pillow 30958.1/69166: 45% mana arcane_charge(4), crimson_chorus(3), combat_analysis(10)
1:22.573 aoe s arcane_explosion Fluffy_Pillow 35505.0/69166: 51% mana crimson_chorus(3), combat_analysis(10)
1:23.861 aoe s arcane_explosion Fluffy_Pillow 32286.7/69166: 47% mana arcane_charge, crimson_chorus(3), combat_analysis(10)
1:25.146 aoe r arcane_missiles Fluffy_Pillow 29064.3/69166: 42% mana arcane_charge(2), clearcasting, crimson_chorus(3), combat_analysis(10)
1:27.179 aoe s arcane_explosion Fluffy_Pillow 31876.6/69166: 46% mana arcane_charge(2), crimson_chorus(3), combat_analysis(10)
1:28.467 aoe s arcane_explosion Fluffy_Pillow 28658.3/69166: 41% mana arcane_charge(3), crimson_chorus(3), combat_analysis(10)
1:29.753 aoe t arcane_barrage Fluffy_Pillow 25437.2/69166: 37% mana arcane_charge(4), crimson_chorus(3), combat_analysis(10)
1:31.040 aoe s arcane_explosion Fluffy_Pillow 29984.2/69166: 43% mana combat_analysis(10)
1:32.327 aoe r arcane_missiles Fluffy_Pillow 26764.5/69166: 39% mana arcane_charge, clearcasting, combat_analysis(10)
1:34.288 aoe s arcane_explosion Fluffy_Pillow 29477.2/69166: 43% mana arcane_charge, combat_analysis(10)
1:35.574 aoe s arcane_explosion Fluffy_Pillow 26256.1/69166: 38% mana arcane_charge(2), combat_analysis(10)
1:36.860 aoe s arcane_explosion Fluffy_Pillow 23035.1/69166: 33% mana arcane_charge(3), combat_analysis(10)
1:38.147 aoe t arcane_barrage Fluffy_Pillow 19815.4/69166: 29% mana arcane_charge(4), combat_analysis(10)
1:39.433 aoe q arcane_orb Fluffy_Pillow 24361.0/69166: 35% mana combat_analysis(10)
1:40.718 aoe t arcane_barrage Fluffy_Pillow 25638.5/69166: 37% mana arcane_charge(4), combat_analysis(10)
1:42.002 aoe s arcane_explosion Fluffy_Pillow 30181.3/69166: 44% mana combat_analysis(10)
1:43.289 aoe s arcane_explosion Fluffy_Pillow 26961.7/69166: 39% mana arcane_charge, combat_analysis(10)
1:44.576 aoe r arcane_missiles Fluffy_Pillow 23742.0/69166: 34% mana arcane_charge(2), clearcasting, combat_analysis(10)
1:46.536 aoe s arcane_explosion Fluffy_Pillow 26453.3/69166: 38% mana arcane_charge(2), combat_analysis(10)
1:47.822 aoe s arcane_explosion Fluffy_Pillow 23232.2/69166: 34% mana arcane_charge(3), combat_analysis(10)
1:49.109 aoe t arcane_barrage Fluffy_Pillow 20012.6/69166: 29% mana arcane_charge(4), combat_analysis(10)
1:50.396 aoe n touch_of_the_magi Fluffy_Pillow 24559.5/69166: 36% mana combat_analysis(10)
1:51.682 aoe p rune_of_power Fluffy_Pillow 23838.4/69166: 34% mana arcane_charge(4), combat_analysis(10)
1:52.967 aoe t arcane_barrage Fluffy_Pillow 25616.0/69166: 37% mana arcane_charge(4), rune_of_power, combat_analysis(10)
1:54.254 aoe s arcane_explosion Fluffy_Pillow 30163.0/69166: 44% mana rune_of_power, combat_analysis(10)
1:55.541 aoe s arcane_explosion Fluffy_Pillow 26943.3/69166: 39% mana arcane_charge, rune_of_power, combat_analysis(10)
1:56.829 aoe s arcane_explosion Fluffy_Pillow 23725.0/69166: 34% mana arcane_charge(2), rune_of_power, combat_analysis(10)
1:58.115 aoe s arcane_explosion Fluffy_Pillow 20503.9/69166: 30% mana arcane_charge(3), rune_of_power, combat_analysis(10)
1:59.403 aoe t arcane_barrage Fluffy_Pillow 17285.6/69166: 25% mana arcane_charge(4), rune_of_power, combat_analysis(10)
2:00.689 aoe q arcane_orb Fluffy_Pillow 21831.2/69166: 32% mana rune_of_power, combat_analysis(10)
2:01.975 aoe t arcane_barrage Fluffy_Pillow 23110.2/69166: 33% mana arcane_charge(4), rune_of_power, crimson_chorus, combat_analysis(10)
2:03.261 aoe s arcane_explosion Fluffy_Pillow 27655.7/69166: 40% mana rune_of_power, crimson_chorus, combat_analysis(10)
2:04.546 aoe s arcane_explosion Fluffy_Pillow 24433.3/69166: 35% mana arcane_charge, rune_of_power, crimson_chorus, combat_analysis(10)
2:05.832 aoe s arcane_explosion Fluffy_Pillow 21212.2/69166: 31% mana arcane_charge(2), crimson_chorus, combat_analysis(10)
2:07.118 aoe s arcane_explosion Fluffy_Pillow 17991.2/69166: 26% mana arcane_charge(3), crimson_chorus, combat_analysis(10)
2:08.405 aoe o arcane_power Fluffy_Pillow 14771.5/69166: 21% mana arcane_charge(4), clearcasting, crimson_chorus, combat_analysis(10)
2:08.405 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 14771.5/69166: 21% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, combat_analysis(10)
2:08.405 aoe r arcane_missiles Fluffy_Pillow 14771.5/69166: 21% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, combat_analysis(10), gladiators_badge
2:10.483 aoe t arcane_barrage Fluffy_Pillow 17646.0/69166: 26% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, combat_analysis(10), gladiators_badge
2:11.770 aoe s arcane_explosion Fluffy_Pillow 22193.0/69166: 32% mana arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
2:13.057 aoe s arcane_explosion Fluffy_Pillow 21473.3/69166: 31% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
2:14.342 aoe s arcane_explosion Fluffy_Pillow 20750.9/69166: 30% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
2:15.629 aoe s arcane_explosion Fluffy_Pillow 20031.2/69166: 29% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
2:16.914 aoe t arcane_barrage Fluffy_Pillow 19308.7/69166: 28% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
2:18.201 aoe s arcane_explosion Fluffy_Pillow 23855.7/69166: 34% mana arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
2:19.487 aoe s arcane_explosion Fluffy_Pillow 23134.6/69166: 33% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
2:20.775 aoe s arcane_explosion Fluffy_Pillow 22416.4/69166: 32% mana arcane_charge(2), arcane_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
2:22.061 aoe s arcane_explosion Fluffy_Pillow 21695.3/69166: 31% mana arcane_charge(3), arcane_power, crimson_chorus(3), combat_analysis(10), gladiators_badge
2:23.349 aoe t arcane_barrage Fluffy_Pillow 20977.0/69166: 30% mana arcane_charge(4), arcane_power, crimson_chorus(3), combat_analysis(10), gladiators_badge
2:24.634 shared_cds v use_mana_gem mechagnome 25521.2/69166: 37% mana crimson_chorus(3), combat_analysis(10)
2:24.634 aoe q arcane_orb Fluffy_Pillow 32437.8/69166: 47% mana crimson_chorus(3), combat_analysis(10)
2:25.919 aoe t arcane_barrage Fluffy_Pillow 33715.3/69166: 49% mana arcane_charge(4), crimson_chorus(3), combat_analysis(10)
2:27.205 aoe s arcane_explosion Fluffy_Pillow 38260.9/69166: 55% mana crimson_chorus(3), combat_analysis(10)
2:28.492 aoe s arcane_explosion Fluffy_Pillow 35041.2/69166: 51% mana arcane_charge, crimson_chorus(3), combat_analysis(10)
2:29.777 aoe r arcane_missiles Fluffy_Pillow 31818.8/69166: 46% mana arcane_charge(2), clearcasting, crimson_chorus(3), combat_analysis(10)
2:31.726 aoe s arcane_explosion Fluffy_Pillow 34514.9/69166: 50% mana arcane_charge(2), combat_analysis(10)
2:33.012 aoe s arcane_explosion Fluffy_Pillow 31293.8/69166: 45% mana arcane_charge(3), combat_analysis(10)
2:34.296 aoe r arcane_missiles Fluffy_Pillow 28070.0/69166: 41% mana arcane_charge(4), clearcasting, combat_analysis(10)
2:36.340 aoe t arcane_barrage Fluffy_Pillow 30897.5/69166: 45% mana arcane_charge(4), combat_analysis(10)
2:37.625 aoe n touch_of_the_magi Fluffy_Pillow 35441.7/69166: 51% mana combat_analysis(10)
2:38.911 aoe p rune_of_power Fluffy_Pillow 34720.6/69166: 50% mana arcane_charge(4), combat_analysis(10)
2:40.197 aoe t arcane_barrage Fluffy_Pillow 36499.5/69166: 53% mana arcane_charge(4), rune_of_power, combat_analysis(10)
2:41.485 aoe s arcane_explosion Fluffy_Pillow 41047.9/69166: 59% mana rune_of_power, combat_analysis(10)
2:42.770 aoe r arcane_missiles Fluffy_Pillow 37825.4/69166: 55% mana arcane_charge, clearcasting, rune_of_power, combat_analysis(10)
2:44.696 aoe s arcane_explosion Fluffy_Pillow 40489.7/69166: 59% mana arcane_charge, rune_of_power, combat_analysis(10)
2:45.983 aoe r arcane_missiles Fluffy_Pillow 37270.0/69166: 54% mana arcane_charge(2), clearcasting, rune_of_power, combat_analysis(10)
2:48.165 aoe s arcane_explosion Fluffy_Pillow 40288.4/69166: 58% mana arcane_charge(2), rune_of_power, combat_analysis(10)
2:49.450 aoe s arcane_explosion Fluffy_Pillow 37066.0/69166: 54% mana arcane_charge(3), rune_of_power, combat_analysis(10)
2:50.735 aoe t arcane_barrage Fluffy_Pillow 33843.5/69166: 49% mana arcane_charge(4), rune_of_power, combat_analysis(10)
2:52.020 aoe q arcane_orb Fluffy_Pillow 38387.7/69166: 56% mana rune_of_power, combat_analysis(10)
2:53.303 aoe t arcane_barrage Fluffy_Pillow 39662.5/69166: 57% mana arcane_charge(4), combat_analysis(10)
2:54.591 aoe s arcane_explosion Fluffy_Pillow 44210.9/69166: 64% mana combat_analysis(10)
2:55.877 aoe s arcane_explosion Fluffy_Pillow 40989.8/69166: 59% mana arcane_charge, combat_analysis(10)
2:57.165 aoe s arcane_explosion Fluffy_Pillow 37771.5/69166: 55% mana arcane_charge(2), combat_analysis(10)
2:58.449 aoe r arcane_missiles Fluffy_Pillow 34547.7/69166: 50% mana arcane_charge(3), clearcasting, combat_analysis(10)
3:00.416 aoe s arcane_explosion Fluffy_Pillow 37268.7/69166: 54% mana arcane_charge(3), combat_analysis(10)
3:01.705 aoe t arcane_barrage Fluffy_Pillow 34051.8/69166: 49% mana arcane_charge(4), combat_analysis(10)
3:02.991 aoe s arcane_explosion Fluffy_Pillow 38597.3/69166: 56% mana crimson_chorus, combat_analysis(10)
3:04.278 aoe s arcane_explosion Fluffy_Pillow 35377.6/69166: 51% mana arcane_charge, crimson_chorus, combat_analysis(10)
3:05.564 aoe s arcane_explosion Fluffy_Pillow 32156.6/69166: 46% mana arcane_charge(2), crimson_chorus, combat_analysis(10)
3:06.852 aoe s arcane_explosion Fluffy_Pillow 28938.3/69166: 42% mana arcane_charge(3), crimson_chorus, combat_analysis(10)
3:08.139 aoe t arcane_barrage Fluffy_Pillow 25718.6/69166: 37% mana arcane_charge(4), crimson_chorus, combat_analysis(10)
3:09.428 aoe s arcane_explosion Fluffy_Pillow 30268.3/69166: 44% mana crimson_chorus, combat_analysis(10)
3:10.714 aoe s arcane_explosion Fluffy_Pillow 27047.3/69166: 39% mana arcane_charge, crimson_chorus, combat_analysis(10)
3:12.002 aoe r arcane_missiles Fluffy_Pillow 23829.0/69166: 34% mana arcane_charge(2), clearcasting, crimson_chorus, combat_analysis(10)
3:13.941 aoe s arcane_explosion Fluffy_Pillow 26511.2/69166: 38% mana arcane_charge(2), crimson_chorus(2), combat_analysis(10)
3:15.228 aoe s arcane_explosion Fluffy_Pillow 23291.6/69166: 34% mana arcane_charge(3), crimson_chorus(2), combat_analysis(10)
3:16.515 aoe t arcane_barrage Fluffy_Pillow 20071.9/69166: 29% mana arcane_charge(4), crimson_chorus(2), combat_analysis(10)
3:17.802 aoe q arcane_orb Fluffy_Pillow 24618.8/69166: 36% mana crimson_chorus(2), combat_analysis(10)
3:19.086 aoe t arcane_barrage Fluffy_Pillow 25895.0/69166: 37% mana arcane_charge(4), crimson_chorus(2), combat_analysis(10)
3:20.372 aoe s arcane_explosion Fluffy_Pillow 30440.6/69166: 44% mana crimson_chorus(2), combat_analysis(10)
3:21.660 aoe s arcane_explosion Fluffy_Pillow 27222.3/69166: 39% mana arcane_charge, crimson_chorus(2), combat_analysis(10)
3:22.949 aoe s arcane_explosion Fluffy_Pillow 24005.4/69166: 35% mana arcane_charge(2), crimson_chorus(3), combat_analysis(10)
3:24.234 aoe s arcane_explosion Fluffy_Pillow 20783.0/69166: 30% mana arcane_charge(3), crimson_chorus(3), combat_analysis(10)
3:25.521 aoe t arcane_barrage Fluffy_Pillow 17563.3/69166: 25% mana arcane_charge(4), crimson_chorus(3), combat_analysis(10)
3:26.808 aoe n touch_of_the_magi Fluffy_Pillow 22110.2/69166: 32% mana crimson_chorus(3), combat_analysis(10)
3:28.094 aoe p rune_of_power Fluffy_Pillow 21389.2/69166: 31% mana arcane_charge(4), crimson_chorus(3), combat_analysis(10)
3:29.380 aoe t arcane_barrage Fluffy_Pillow 23168.1/69166: 33% mana arcane_charge(4), rune_of_power, crimson_chorus(3), combat_analysis(10)
3:30.667 aoe s arcane_explosion Fluffy_Pillow 27715.1/69166: 40% mana rune_of_power, crimson_chorus(3), combat_analysis(10)
3:31.955 aoe r arcane_missiles Fluffy_Pillow 24496.8/69166: 35% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(3), combat_analysis(10)
3:34.056 aoe s arcane_explosion Fluffy_Pillow 27403.1/69166: 40% mana arcane_charge, rune_of_power, combat_analysis(10)
3:35.342 aoe r arcane_missiles Fluffy_Pillow 24182.1/69166: 35% mana arcane_charge(2), clearcasting, rune_of_power, combat_analysis(10)
3:37.262 aoe s arcane_explosion Fluffy_Pillow 26838.0/69166: 39% mana arcane_charge(2), rune_of_power, combat_analysis(10)
3:38.550 aoe s arcane_explosion Fluffy_Pillow 23619.7/69166: 34% mana arcane_charge(3), rune_of_power, combat_analysis(10)
3:39.836 aoe t arcane_barrage Fluffy_Pillow 20398.7/69166: 29% mana arcane_charge(4), rune_of_power, combat_analysis(10)
3:41.123 aoe q arcane_orb Fluffy_Pillow 24945.6/69166: 36% mana rune_of_power, combat_analysis(10)
3:42.410 aoe t arcane_barrage Fluffy_Pillow 26226.0/69166: 38% mana arcane_charge(4), combat_analysis(10)
3:43.695 aoe s arcane_explosion Fluffy_Pillow 30770.1/69166: 44% mana combat_analysis(10)
3:44.983 aoe s arcane_explosion Fluffy_Pillow 27551.9/69166: 40% mana arcane_charge, combat_analysis(10)
3:46.270 aoe s arcane_explosion Fluffy_Pillow 24332.2/69166: 35% mana arcane_charge(2), combat_analysis(10)
3:47.557 aoe s arcane_explosion Fluffy_Pillow 21112.5/69166: 31% mana arcane_charge(3), combat_analysis(10)
3:48.842 aoe t arcane_barrage Fluffy_Pillow 17890.1/69166: 26% mana arcane_charge(4), combat_analysis(10)
3:50.130 aoe s arcane_explosion Fluffy_Pillow 22438.4/69166: 32% mana combat_analysis(10)
3:51.417 aoe s arcane_explosion Fluffy_Pillow 19218.7/69166: 28% mana arcane_charge, combat_analysis(10)
3:52.705 aoe s arcane_explosion Fluffy_Pillow 16000.4/69166: 23% mana arcane_charge(2), combat_analysis(10)
3:53.991 aoe s arcane_explosion Fluffy_Pillow 12779.4/69166: 18% mana arcane_charge(3), combat_analysis(10)
3:55.278 aoe t arcane_barrage Fluffy_Pillow 9559.7/69166: 14% mana arcane_charge(4), combat_analysis(10)
3:56.566 aoe s arcane_explosion Fluffy_Pillow 14108.0/69166: 20% mana combat_analysis(10)
3:57.853 aoe s arcane_explosion Fluffy_Pillow 10888.4/69166: 16% mana arcane_charge, combat_analysis(10)
3:59.141 aoe s arcane_explosion Fluffy_Pillow 7670.1/69166: 11% mana arcane_charge(2), combat_analysis(10)
4:00.426 aoe u evocation mechagnome 4447.6/69166: 6% mana arcane_charge(3), combat_analysis(10)
4:04.701 aoe s arcane_explosion Fluffy_Pillow 63197.2/69166: 91% mana arcane_charge(3), combat_analysis(10)
4:05.987 aoe t arcane_barrage Fluffy_Pillow 59976.1/69166: 87% mana arcane_charge(4), crimson_chorus, combat_analysis(10)
4:07.275 aoe q arcane_orb Fluffy_Pillow 64524.5/69166: 93% mana crimson_chorus, combat_analysis(10)
4:08.561 aoe t arcane_barrage Fluffy_Pillow 65803.4/69166: 95% mana arcane_charge(4), crimson_chorus, combat_analysis(10)
4:09.849 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana crimson_chorus, combat_analysis(10)
4:11.135 aoe s arcane_explosion Fluffy_Pillow 65944.7/69166: 95% mana arcane_charge, crimson_chorus, combat_analysis(10)
4:12.422 aoe s arcane_explosion Fluffy_Pillow 62725.0/69166: 91% mana arcane_charge(2), crimson_chorus, combat_analysis(10)
4:13.708 aoe s arcane_explosion Fluffy_Pillow 59503.9/69166: 86% mana arcane_charge(3), crimson_chorus, combat_analysis(10)
4:14.996 aoe t arcane_barrage Fluffy_Pillow 56285.6/69166: 81% mana arcane_charge(4), crimson_chorus(2), combat_analysis(10)
4:16.280 aoe n touch_of_the_magi Fluffy_Pillow 60828.4/69166: 88% mana crimson_chorus(2), combat_analysis(10)
4:17.569 aoe o arcane_power Fluffy_Pillow 60111.5/69166: 87% mana arcane_charge(4), crimson_chorus(2), combat_analysis(10)
4:17.569 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 60111.5/69166: 87% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10)
4:17.569 aoe t arcane_barrage Fluffy_Pillow 60111.5/69166: 87% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
4:18.856 aoe s arcane_explosion Fluffy_Pillow 64658.5/69166: 93% mana arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
4:20.144 aoe s arcane_explosion Fluffy_Pillow 63940.2/69166: 92% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
4:21.432 aoe s arcane_explosion Fluffy_Pillow 63221.9/69166: 91% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
4:22.717 aoe s arcane_explosion Fluffy_Pillow 62499.5/69166: 90% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
4:24.005 aoe t arcane_barrage Fluffy_Pillow 61781.2/69166: 89% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), combat_analysis(10), gladiators_badge
4:25.292 aoe s arcane_explosion Fluffy_Pillow 66328.1/69166: 96% mana arcane_power, rune_of_power, crimson_chorus(3), combat_analysis(10), gladiators_badge
4:26.579 aoe r arcane_missiles Fluffy_Pillow 65608.4/69166: 95% mana arcane_charge, arcane_power, clearcasting, rune_of_power, crimson_chorus(3), combat_analysis(10), gladiators_badge
4:28.568 aoe s arcane_explosion Fluffy_Pillow 68359.9/69166: 99% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), combat_analysis(10), gladiators_badge
4:29.855 aoe s arcane_explosion Fluffy_Pillow 67640.2/69166: 98% mana arcane_charge(2), arcane_power, crimson_chorus(3), combat_analysis(10), gladiators_badge
4:31.142 aoe s arcane_explosion Fluffy_Pillow 66920.5/69166: 97% mana arcane_charge(3), arcane_power, crimson_chorus(3), combat_analysis(10), gladiators_badge
4:32.427 aoe p rune_of_power Fluffy_Pillow 66198.1/69166: 96% mana arcane_charge(4), arcane_power, crimson_chorus(3), combat_analysis(10), gladiators_badge
4:33.715 aoe t arcane_barrage Fluffy_Pillow 67979.8/69166: 98% mana arcane_charge(4), rune_of_power, crimson_chorus(3), combat_analysis(10)
4:35.002 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana rune_of_power, combat_analysis(10)
4:36.290 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana arcane_charge(4), rune_of_power, combat_analysis(10)
4:37.577 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana rune_of_power, combat_analysis(10)
4:38.865 aoe s arcane_explosion Fluffy_Pillow 65947.4/69166: 95% mana arcane_charge, rune_of_power, combat_analysis(10)
4:40.151 aoe s arcane_explosion Fluffy_Pillow 62726.4/69166: 91% mana arcane_charge(2), rune_of_power, combat_analysis(10)
4:41.437 aoe s arcane_explosion Fluffy_Pillow 59505.3/69166: 86% mana arcane_charge(3), rune_of_power, combat_analysis(10)
4:42.724 shared_cds v use_mana_gem mechagnome 56285.6/69166: 81% mana arcane_charge(4), clearcasting, rune_of_power, combat_analysis(10)
4:42.724 aoe r arcane_missiles Fluffy_Pillow 63202.2/69166: 91% mana arcane_charge(4), clearcasting, rune_of_power, combat_analysis(10)
4:44.775 aoe t arcane_barrage Fluffy_Pillow 66039.4/69166: 95% mana arcane_charge(4), rune_of_power, combat_analysis(10)
4:46.064 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana combat_analysis(10)
4:47.350 aoe s arcane_explosion Fluffy_Pillow 65944.7/69166: 95% mana arcane_charge, combat_analysis(10)
4:48.636 aoe s arcane_explosion Fluffy_Pillow 62723.6/69166: 91% mana arcane_charge(2), combat_analysis(10)
4:49.922 aoe s arcane_explosion Fluffy_Pillow 59502.5/69166: 86% mana arcane_charge(3), combat_analysis(10)
4:51.207 aoe t arcane_barrage Fluffy_Pillow 56280.1/69166: 81% mana arcane_charge(4), combat_analysis(10)
4:52.493 aoe s arcane_explosion Fluffy_Pillow 60825.7/69166: 88% mana combat_analysis(10)
4:53.781 aoe s arcane_explosion Fluffy_Pillow 57607.4/69166: 83% mana arcane_charge, combat_analysis(10)
4:55.067 aoe s arcane_explosion Fluffy_Pillow 54386.3/69166: 79% mana arcane_charge(2), combat_analysis(10)
4:56.355 aoe s arcane_explosion Fluffy_Pillow 51168.0/69166: 74% mana arcane_charge(3), combat_analysis(10)
4:57.642 aoe t arcane_barrage Fluffy_Pillow 47948.4/69166: 69% mana arcane_charge(4), combat_analysis(10)
4:58.928 aoe q arcane_orb Fluffy_Pillow 52493.9/69166: 76% mana combat_analysis(10)
5:00.214 aoe t arcane_barrage Fluffy_Pillow 53772.9/69166: 78% mana arcane_charge(4), combat_analysis(10)
5:01.501 aoe s arcane_explosion Fluffy_Pillow 58319.8/69166: 84% mana combat_analysis(10)

Stats

Level Bonus (60) Race Bonus (mechagnome) Raid-Buffed Unbuffed Gear Amount
Strength 198 -2 196 196 0
Agility 306 1 307 307 0
Stamina 414 -1 2026 1930 1517
Intellect 450 2 1798 1618 1089 (46)
Spirit 0 0 0 0 0
Health 40520 38600 0
Mana 69166 69166 0
Spell Power 1798 1618 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="mechagnome"
source=default
spec=arcane
level=60
race=mechagnome
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

night_elf : 8864 dps, 4532 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8864.1 8864.1 16.0 / 0.181% 1059.5 / 12.0% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2045.0 1938.8 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
night_elf 8864
Arcane Barrage 3735 42.2% 50.0 6.02sec 22464 18162 Direct 149.9 6302 12886 7501 18.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.03 149.91 0.00 0.00 1.2369 0.0000 1123977.45 1123977.45 0.00% 18161.77 18161.77
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.79% 122.61 85 156 6301.66 2172 30728 6295.15 5445 7057 772706 772706 0.00%
crit 18.21% 27.30 11 45 12886.48 4344 61455 12864.56 8172 19939 351271 351271 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.03
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 910 1820 1042 14.5%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1041.86 1041.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 85.51% 0.86 0 1 910.00 910 910 778.14 0 910 778 778 0.00%
crit 14.49% 0.14 0 1 1819.99 1820 1820 263.72 0 1820 264 264 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2927 33.0% 129.6 2.29sec 6788 5503 Direct 388.8 1899 3891 2263 18.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.61 388.84 0.00 0.00 1.2334 0.0000 879765.74 879765.74 0.00% 5503.08 5503.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.73% 317.81 228 403 1898.98 1452 3572 1899.55 1767 2024 603490 603490 0.00%
crit 18.27% 71.02 43 110 3890.55 2903 7144 3889.49 3323 4399 276276 276276 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.61
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1007 11.4% 24.3 11.96sec 12443 6552 Periodic 193.9 1315 2675 1561 18.1% 4.4%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.32 0.00 194.07 193.94 1.8992 0.2065 302657.00 302657.00 0.00% 6551.73 6551.73
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 81.94% 158.91 67 266 1315.32 1064 2618 1314.20 1125 1592 208992 208992 0.00%
crit 18.06% 35.03 11 68 2674.62 2128 5236 2674.21 2178 3685 93665 93665 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.32
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (595) 0.0% (6.7%) 12.7 24.35sec 14064 11343

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.71 0.00 0.00 0.00 1.2399 0.0000 0.00 0.00 0.00% 11343.17 11343.17

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.71
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 595 6.7% 38.1 24.36sec 4695 0 Direct 38.1 3940 8057 4696 18.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.07 38.07 0.00 0.00 0.0000 0.0000 178756.98 178756.98 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.63% 31.08 17 43 3940.02 2869 7059 3938.17 3223 4563 122417 122417 0.00%
crit 18.37% 7.00 1 17 8057.39 5738 14118 8081.29 5738 14118 56340 56340 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 13.7 1.82sec 515 0 Periodic 40.3 (42.2) 112 0 112 0.0% (0.0%) 4.4%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.74 0.00 40.31 40.31 0.0000 0.9867 4520.77 4520.77 0.00% 178.06 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.31 13 63 112.14 0 202 112.25 64 165 4521 4521 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 10.12sec 1344 0 Direct 1.9 1113 2229 1345 20.8%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.91 1.91 0.00 0.00 0.0000 0.0000 2561.03 2561.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.25% 1.51 0 3 1113.04 1093 1158 1047.18 0 1158 1680 1680 0.00%
crit 20.75% 0.40 0 2 2228.79 2185 2316 797.13 0 2316 881 881 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.2 14.55sec 534 0 Direct 20.2 452 905 534 18.0%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.21 20.21 0.00 0.00 0.0000 0.0000 10785.44 10785.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.02% 16.58 7 30 452.23 444 470 452.27 444 464 7498 7498 0.00%
crit 17.98% 3.63 0 10 904.61 887 941 882.67 0 941 3288 3288 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4124 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 103  / 14 0.2% 90.0 1.31sec 46 35 Direct 90.0 38 78 46 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4124.27 4124.27 0.00% 34.53 34.53
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 72.60 60 85 38.23 30 46 38.23 37 39 2776 2776 0.00%
crit 19.33% 17.40 5 30 77.52 59 92 77.52 67 87 1348 1348 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (523) 0.0% (5.9%) 6.2 52.09sec 25347 19704

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19703.68 19703.68

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 523 5.9% 6.2 52.00sec 25347 0 Direct 18.5 8492 0 8492 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.54 0.00 0.00 0.0000 0.0000 157294.48 157294.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.54 15 21 8491.79 1217 46102 8472.45 5742 12482 157294 157294 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:15916.71
  • base_dd_max:15916.71
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
night_elf
Arcane Power 2.9 127.13sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.50 0.00 2.95 0.00 4.2104 0.7099 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:night_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.50
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:night_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:night_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.23sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2376 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.07
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.23sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:night_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.8 136.8 6.0sec 1.6sec 4.6sec 78.06% 0.00% 3.0 (4.1) 0.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 17.9s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.4s

Stack Uptimes

  • arcane_charge_1:20.68%
  • arcane_charge_2:17.72%
  • arcane_charge_3:16.81%
  • arcane_charge_4:22.85%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.1sec 127.1sec 14.7sec 14.05% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 141.2s
  • trigger_min/max:120.0s / 141.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.05%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.5 0.0 11.9sec 11.9sec 1.3sec 10.48% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.47%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.06% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.9s
  • trigger_min/max:60.0s / 65.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.95%
  • crimson_chorus_2:17.33%
  • crimson_chorus_3:16.78%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 221.0sec 221.0sec 4.2sec 0.70% 0.00% 2.0 (2.0) 0.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:221.0s / 221.0s
  • trigger_min/max:221.0s / 221.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 4.3s

Stack Uptimes

  • evocation_1:0.70%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.9 0.0 86.7sec 86.7sec 14.6sec 19.07% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 141.2s
  • trigger_min/max:60.0s / 141.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.07%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 35.02% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 58.3s
  • trigger_min/max:12.1s / 58.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.02%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.89% 0.77% 5.43% 0.9s 0.0s 4.6s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation220.72789.233355.935269.047151.903359.985
Rune of Power6.0930.00430.72538.52216.78578.325
Touch of the Magi4.8500.00025.24731.69114.38274.373
Arcane Power5.0770.00021.15314.8101.96932.051
Arcane Barrage3.5190.00314.082177.829137.156220.424
Arcane Orb4.2350.00016.60654.52629.00185.856

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
night_elf
mana_regen Mana 1046.14 406130.03 69.64% 388.22 9343.26 2.25%
Evocation Mana 23.13 25985.99 4.46% 1123.37 0.00 0.00%
Mana Gem Mana 2.74 18980.93 3.25% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.03 132067.41 22.65% 2639.81 6344.52 4.58%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1938.77 2044.98 15659.2 37216.9 624.1 69165.7
Usage Type Count Total Avg RPE APR
night_elf
arcane_explosion Mana 129.6 592398.6 4570.7 4570.5 1.5
arcane_orb Mana 12.7 5788.6 455.4 455.4 30.9
touch_of_the_magi Mana 6.2 15502.6 2499.3 2498.1 10.1

Statistics & Data Analysis

Fight Length
night_elf Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
night_elf Damage Per Second
Count 1118
Mean 8864.09
Minimum 8045.08
Maximum 9791.03
Spread ( max - min ) 1745.95
Range [ ( max - min ) / 2 * 100% ] 9.85%
Standard Deviation 273.6361
5th Percentile 8420.28
95th Percentile 9331.87
( 95th Percentile - 5th Percentile ) 911.58
Mean Distribution
Standard Deviation 8.1838
95.00% Confidence Interval ( 8848.05 - 8880.13 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3661
0.1 Scale Factor Error with Delta=300 640
0.05 Scale Factor Error with Delta=300 2557
0.01 Scale Factor Error with Delta=300 63920
Priority Target DPS
night_elf Priority Target Damage Per Second
Count 1118
Mean 4532.11
Minimum 3995.51
Maximum 5286.57
Spread ( max - min ) 1291.06
Range [ ( max - min ) / 2 * 100% ] 14.24%
Standard Deviation 195.0589
5th Percentile 4224.58
95th Percentile 4856.63
( 95th Percentile - 5th Percentile ) 632.05
Mean Distribution
Standard Deviation 5.8337
95.00% Confidence Interval ( 4520.68 - 4543.54 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7116
0.1 Scale Factor Error with Delta=300 325
0.05 Scale Factor Error with Delta=300 1300
0.01 Scale Factor Error with Delta=300 32480
DPS(e)
night_elf Damage Per Second (Effective)
Count 1118
Mean 8864.09
Minimum 8045.08
Maximum 9791.03
Spread ( max - min ) 1745.95
Range [ ( max - min ) / 2 * 100% ] 9.85%
Damage
night_elf Damage
Count 1118
Mean 2661360.75
Minimum 1971004.47
Maximum 3259702.82
Spread ( max - min ) 1288698.36
Range [ ( max - min ) / 2 * 100% ] 24.21%
DTPS
night_elf Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
night_elf Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
night_elf Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
night_elf Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
night_elf Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
night_elf Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
night_elfTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
night_elf Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.07 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.71 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.32 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.61 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.03 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.50 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.93 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxtqtsssstsssstssssptsssvrsrtqtssrsstssrsstsrssstqtsssstsrnxptsssrsrtqtsssstsssstsrssstqtsrssstnptssrssrtqoxtsssstsrsssvtsssstqtsssstnptsssstssrsrstqtssrsstsssstsssstqtnptsssrstsssstqtssrsstsssrsrtqtsrsnoxtsssstvssssptqtsrsrsstssrssrtqtssss

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask night_elf 69165.7/69166: 100% mana
Pre precombat U food night_elf 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana
0:01.286 aoe o arcane_power Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, crimson_chorus
0:01.286 shared_cds w potion Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:01.286 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.286 aoe t arcane_barrage Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.275 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.266 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.256 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.247 aoe s arcane_explosion Fluffy_Pillow 68036.6/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.238 aoe s arcane_explosion Fluffy_Pillow 66907.4/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.227 aoe s arcane_explosion Fluffy_Pillow 65775.5/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.217 aoe t arcane_barrage Fluffy_Pillow 64645.0/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.207 aoe s arcane_explosion Fluffy_Pillow 68781.1/69166: 99% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.199 aoe s arcane_explosion Fluffy_Pillow 67653.4/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.189 aoe s arcane_explosion Fluffy_Pillow 66522.9/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.179 aoe s arcane_explosion Fluffy_Pillow 65392.3/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.168 aoe t arcane_barrage Fluffy_Pillow 64260.4/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.158 aoe s arcane_explosion Fluffy_Pillow 68396.5/69166: 99% mana bloodlust, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.150 aoe s arcane_explosion Fluffy_Pillow 67268.8/69166: 97% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.142 aoe s arcane_explosion Fluffy_Pillow 66141.0/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.133 aoe s arcane_explosion Fluffy_Pillow 65011.9/69166: 94% mana bloodlust, arcane_charge(3), crimson_chorus(2), potion_of_deathly_fixation
0:18.124 aoe p rune_of_power Fluffy_Pillow 61382.8/69166: 89% mana bloodlust, arcane_charge(4), crimson_chorus(2), potion_of_deathly_fixation
0:19.112 aoe t arcane_barrage Fluffy_Pillow 62749.5/69166: 91% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.105 aoe s arcane_explosion Fluffy_Pillow 66889.7/69166: 97% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.095 aoe s arcane_explosion Fluffy_Pillow 63259.2/69166: 91% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.086 aoe s arcane_explosion Fluffy_Pillow 59630.1/69166: 86% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.078 shared_cds v use_mana_gem night_elf 56002.3/69166: 81% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.078 aoe r arcane_missiles Fluffy_Pillow 62918.9/69166: 91% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.660 aoe s arcane_explosion Fluffy_Pillow 65107.3/69166: 94% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.651 aoe r arcane_missiles Fluffy_Pillow 61478.2/69166: 89% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.366 aoe t arcane_barrage Fluffy_Pillow 63850.6/69166: 92% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3)
0:28.357 aoe q arcane_orb Fluffy_Pillow 67988.1/69166: 98% mana bloodlust, rune_of_power, crimson_chorus(3)
0:29.347 aoe t arcane_barrage Fluffy_Pillow 68857.5/69166: 100% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3)
0:30.339 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power
0:31.329 aoe s arcane_explosion Fluffy_Pillow 65535.2/69166: 95% mana bloodlust, arcane_charge
0:32.320 aoe r arcane_missiles Fluffy_Pillow 61906.1/69166: 90% mana bloodlust, arcane_charge(2), clearcasting
0:33.955 aoe s arcane_explosion Fluffy_Pillow 64167.8/69166: 93% mana bloodlust, arcane_charge(2)
0:34.945 aoe s arcane_explosion Fluffy_Pillow 60537.3/69166: 88% mana bloodlust, arcane_charge(3)
0:35.936 aoe t arcane_barrage Fluffy_Pillow 56908.1/69166: 82% mana bloodlust, arcane_charge(4)
0:36.928 aoe s arcane_explosion Fluffy_Pillow 61047.0/69166: 88% mana bloodlust
0:37.917 aoe s arcane_explosion Fluffy_Pillow 57415.1/69166: 83% mana bloodlust, arcane_charge
0:38.908 aoe r arcane_missiles Fluffy_Pillow 53786.0/69166: 78% mana bloodlust, arcane_charge(2), clearcasting
0:40.548 aoe s arcane_explosion Fluffy_Pillow 56054.6/69166: 81% mana bloodlust, arcane_charge(2)
0:41.539 aoe s arcane_explosion Fluffy_Pillow 52425.5/69166: 76% mana arcane_charge(3)
0:42.827 aoe t arcane_barrage Fluffy_Pillow 49207.2/69166: 71% mana arcane_charge(4)
0:44.113 aoe s arcane_explosion Fluffy_Pillow 53752.7/69166: 78% mana
0:45.399 aoe r arcane_missiles Fluffy_Pillow 50531.7/69166: 73% mana arcane_charge, clearcasting
0:47.370 aoe s arcane_explosion Fluffy_Pillow 53258.2/69166: 77% mana arcane_charge
0:48.656 aoe s arcane_explosion Fluffy_Pillow 50037.1/69166: 72% mana arcane_charge(2)
0:49.943 aoe s arcane_explosion Fluffy_Pillow 46817.5/69166: 68% mana arcane_charge(3)
0:51.230 aoe t arcane_barrage Fluffy_Pillow 43597.8/69166: 63% mana arcane_charge(4)
0:52.518 aoe q arcane_orb Fluffy_Pillow 48146.1/69166: 70% mana
0:53.804 aoe t arcane_barrage Fluffy_Pillow 49425.1/69166: 71% mana arcane_charge(4)
0:55.090 aoe s arcane_explosion Fluffy_Pillow 53970.6/69166: 78% mana
0:56.375 aoe s arcane_explosion Fluffy_Pillow 50748.2/69166: 73% mana arcane_charge
0:57.660 aoe s arcane_explosion Fluffy_Pillow 47525.8/69166: 69% mana arcane_charge(2)
0:58.947 aoe s arcane_explosion Fluffy_Pillow 44306.1/69166: 64% mana arcane_charge(3)
1:00.233 aoe t arcane_barrage Fluffy_Pillow 41085.0/69166: 59% mana arcane_charge(4)
1:01.519 aoe s arcane_explosion Fluffy_Pillow 45630.6/69166: 66% mana crimson_chorus
1:02.807 aoe r arcane_missiles Fluffy_Pillow 42412.3/69166: 61% mana arcane_charge, clearcasting, crimson_chorus
1:04.744 aoe n touch_of_the_magi Fluffy_Pillow 45091.8/69166: 65% mana arcane_charge, crimson_chorus
1:06.029 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 44369.3/69166: 64% mana arcane_charge(4), crimson_chorus
1:06.029 aoe p rune_of_power Fluffy_Pillow 44369.3/69166: 64% mana arcane_charge(4), crimson_chorus, gladiators_badge
1:07.317 aoe t arcane_barrage Fluffy_Pillow 46151.1/69166: 67% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:08.603 aoe s arcane_explosion Fluffy_Pillow 50696.6/69166: 73% mana rune_of_power, crimson_chorus, gladiators_badge
1:09.890 aoe s arcane_explosion Fluffy_Pillow 47476.9/69166: 69% mana arcane_charge, rune_of_power, crimson_chorus, gladiators_badge
1:11.177 aoe s arcane_explosion Fluffy_Pillow 44257.3/69166: 64% mana arcane_charge(2), rune_of_power, crimson_chorus(2), gladiators_badge
1:12.465 aoe r arcane_missiles Fluffy_Pillow 41039.0/69166: 59% mana arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
1:14.463 aoe s arcane_explosion Fluffy_Pillow 43802.8/69166: 63% mana arcane_charge(3), rune_of_power, crimson_chorus(2), gladiators_badge
1:15.750 aoe r arcane_missiles Fluffy_Pillow 40583.2/69166: 59% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
1:17.695 aoe t arcane_barrage Fluffy_Pillow 43273.7/69166: 63% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
1:18.982 aoe q arcane_orb Fluffy_Pillow 47820.7/69166: 69% mana rune_of_power, crimson_chorus(2), gladiators_badge
1:20.268 aoe t arcane_barrage Fluffy_Pillow 49099.6/69166: 71% mana arcane_charge(4), crimson_chorus(2), gladiators_badge
1:21.555 aoe s arcane_explosion Fluffy_Pillow 53646.6/69166: 78% mana crimson_chorus(3)
1:22.842 aoe s arcane_explosion Fluffy_Pillow 50426.9/69166: 73% mana arcane_charge, crimson_chorus(3)
1:24.129 aoe s arcane_explosion Fluffy_Pillow 47207.2/69166: 68% mana arcane_charge(2), crimson_chorus(3)
1:25.416 aoe s arcane_explosion Fluffy_Pillow 43987.5/69166: 64% mana arcane_charge(3), crimson_chorus(3)
1:26.704 aoe t arcane_barrage Fluffy_Pillow 40769.3/69166: 59% mana arcane_charge(4), crimson_chorus(3)
1:27.991 aoe s arcane_explosion Fluffy_Pillow 45316.2/69166: 66% mana crimson_chorus(3)
1:29.277 aoe s arcane_explosion Fluffy_Pillow 42095.1/69166: 61% mana arcane_charge, crimson_chorus(3)
1:30.564 aoe s arcane_explosion Fluffy_Pillow 38875.5/69166: 56% mana arcane_charge(2), crimson_chorus(3)
1:31.852 aoe s arcane_explosion Fluffy_Pillow 35657.2/69166: 52% mana arcane_charge(3)
1:33.138 aoe t arcane_barrage Fluffy_Pillow 32436.1/69166: 47% mana arcane_charge(4)
1:34.425 aoe s arcane_explosion Fluffy_Pillow 36983.1/69166: 53% mana
1:35.712 aoe r arcane_missiles Fluffy_Pillow 33763.4/69166: 49% mana arcane_charge, clearcasting
1:37.612 aoe s arcane_explosion Fluffy_Pillow 36391.7/69166: 53% mana arcane_charge
1:38.898 aoe s arcane_explosion Fluffy_Pillow 33170.6/69166: 48% mana arcane_charge(2)
1:40.184 aoe s arcane_explosion Fluffy_Pillow 29949.6/69166: 43% mana arcane_charge(3)
1:41.471 aoe t arcane_barrage Fluffy_Pillow 26729.9/69166: 39% mana arcane_charge(4)
1:42.757 aoe q arcane_orb Fluffy_Pillow 31275.5/69166: 45% mana
1:44.044 aoe t arcane_barrage Fluffy_Pillow 32555.8/69166: 47% mana arcane_charge(4)
1:45.330 aoe s arcane_explosion Fluffy_Pillow 37101.4/69166: 54% mana
1:46.617 aoe r arcane_missiles Fluffy_Pillow 33881.7/69166: 49% mana arcane_charge, clearcasting
1:48.560 aoe s arcane_explosion Fluffy_Pillow 36569.5/69166: 53% mana arcane_charge
1:49.846 aoe s arcane_explosion Fluffy_Pillow 33348.4/69166: 48% mana arcane_charge(2)
1:51.132 aoe s arcane_explosion Fluffy_Pillow 30127.4/69166: 44% mana arcane_charge(3)
1:52.418 aoe t arcane_barrage Fluffy_Pillow 26906.3/69166: 39% mana arcane_charge(4)
1:53.704 aoe n touch_of_the_magi Fluffy_Pillow 31451.9/69166: 45% mana
1:54.990 aoe p rune_of_power Fluffy_Pillow 30730.8/69166: 44% mana arcane_charge(4)
1:56.279 aoe t arcane_barrage Fluffy_Pillow 32513.9/69166: 47% mana arcane_charge(4), rune_of_power
1:57.563 aoe s arcane_explosion Fluffy_Pillow 37056.7/69166: 54% mana rune_of_power
1:58.850 aoe s arcane_explosion Fluffy_Pillow 33837.0/69166: 49% mana arcane_charge, rune_of_power
2:00.136 aoe r arcane_missiles Fluffy_Pillow 30616.0/69166: 44% mana arcane_charge(2), clearcasting, rune_of_power
2:02.029 aoe s arcane_explosion Fluffy_Pillow 33234.6/69166: 48% mana arcane_charge(2), rune_of_power, crimson_chorus
2:03.317 aoe s arcane_explosion Fluffy_Pillow 30016.3/69166: 43% mana arcane_charge(3), rune_of_power, crimson_chorus
2:04.603 aoe r arcane_missiles Fluffy_Pillow 26795.3/69166: 39% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus
2:06.586 aoe t arcane_barrage Fluffy_Pillow 29538.4/69166: 43% mana arcane_charge(4), rune_of_power, crimson_chorus
2:07.871 aoe q arcane_orb Fluffy_Pillow 34082.6/69166: 49% mana rune_of_power, crimson_chorus
2:09.156 aoe o arcane_power Fluffy_Pillow 35360.1/69166: 51% mana arcane_charge(4), crimson_chorus
2:09.156 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 35360.1/69166: 51% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:09.156 aoe t arcane_barrage Fluffy_Pillow 35360.1/69166: 51% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.443 aoe s arcane_explosion Fluffy_Pillow 39907.1/69166: 58% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:11.729 aoe s arcane_explosion Fluffy_Pillow 39186.0/69166: 57% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.015 aoe s arcane_explosion Fluffy_Pillow 38464.9/69166: 56% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.303 aoe s arcane_explosion Fluffy_Pillow 37746.7/69166: 55% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.592 aoe t arcane_barrage Fluffy_Pillow 37029.7/69166: 54% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.880 aoe s arcane_explosion Fluffy_Pillow 41578.1/69166: 60% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.167 aoe r arcane_missiles Fluffy_Pillow 40858.4/69166: 59% mana arcane_charge, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.102 aoe s arcane_explosion Fluffy_Pillow 43535.1/69166: 63% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:21.388 aoe s arcane_explosion Fluffy_Pillow 42814.1/69166: 62% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
2:22.674 aoe s arcane_explosion Fluffy_Pillow 42093.0/69166: 61% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
2:23.961 shared_cds v use_mana_gem night_elf 41373.3/69166: 60% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
2:23.961 aoe t arcane_barrage Fluffy_Pillow 48289.9/69166: 70% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
2:25.247 aoe s arcane_explosion Fluffy_Pillow 52835.5/69166: 76% mana crimson_chorus(3)
2:26.533 aoe s arcane_explosion Fluffy_Pillow 49614.4/69166: 72% mana arcane_charge, crimson_chorus(3)
2:27.819 aoe s arcane_explosion Fluffy_Pillow 46393.4/69166: 67% mana arcane_charge(2), crimson_chorus(3)
2:29.105 aoe s arcane_explosion Fluffy_Pillow 43172.3/69166: 62% mana arcane_charge(3), crimson_chorus(3)
2:30.391 aoe t arcane_barrage Fluffy_Pillow 39951.2/69166: 58% mana arcane_charge(4), crimson_chorus(3)
2:31.678 aoe q arcane_orb Fluffy_Pillow 44498.2/69166: 64% mana
2:32.964 aoe t arcane_barrage Fluffy_Pillow 45777.1/69166: 66% mana arcane_charge(4)
2:34.252 aoe s arcane_explosion Fluffy_Pillow 50325.5/69166: 73% mana
2:35.536 aoe s arcane_explosion Fluffy_Pillow 47101.7/69166: 68% mana arcane_charge
2:36.823 aoe s arcane_explosion Fluffy_Pillow 43882.0/69166: 63% mana arcane_charge(2)
2:38.111 aoe s arcane_explosion Fluffy_Pillow 40663.7/69166: 59% mana arcane_charge(3)
2:39.397 aoe t arcane_barrage Fluffy_Pillow 37442.6/69166: 54% mana arcane_charge(4)
2:40.683 aoe n touch_of_the_magi Fluffy_Pillow 41988.2/69166: 61% mana
2:41.969 aoe p rune_of_power Fluffy_Pillow 41267.1/69166: 60% mana arcane_charge(4)
2:43.255 aoe t arcane_barrage Fluffy_Pillow 43046.1/69166: 62% mana arcane_charge(4), rune_of_power
2:44.542 aoe s arcane_explosion Fluffy_Pillow 47593.0/69166: 69% mana rune_of_power
2:45.828 aoe s arcane_explosion Fluffy_Pillow 44372.0/69166: 64% mana arcane_charge, rune_of_power
2:47.114 aoe s arcane_explosion Fluffy_Pillow 41150.9/69166: 59% mana arcane_charge(2), rune_of_power
2:48.401 aoe s arcane_explosion Fluffy_Pillow 37931.3/69166: 55% mana arcane_charge(3), rune_of_power
2:49.687 aoe t arcane_barrage Fluffy_Pillow 34710.2/69166: 50% mana arcane_charge(4), rune_of_power
2:50.973 aoe s arcane_explosion Fluffy_Pillow 39255.8/69166: 57% mana rune_of_power
2:52.258 aoe s arcane_explosion Fluffy_Pillow 36033.3/69166: 52% mana arcane_charge, rune_of_power
2:53.544 aoe r arcane_missiles Fluffy_Pillow 32812.3/69166: 47% mana arcane_charge(2), clearcasting, rune_of_power
2:55.490 aoe s arcane_explosion Fluffy_Pillow 35504.2/69166: 51% mana arcane_charge(2)
2:56.777 aoe r arcane_missiles Fluffy_Pillow 32284.5/69166: 47% mana arcane_charge(3), clearcasting
2:58.698 aoe s arcane_explosion Fluffy_Pillow 34941.9/69166: 51% mana arcane_charge(3)
2:59.983 aoe t arcane_barrage Fluffy_Pillow 31719.4/69166: 46% mana arcane_charge(4)
3:01.269 aoe q arcane_orb Fluffy_Pillow 36265.0/69166: 52% mana
3:02.556 aoe t arcane_barrage Fluffy_Pillow 37545.3/69166: 54% mana arcane_charge(4), crimson_chorus
3:03.841 aoe s arcane_explosion Fluffy_Pillow 42089.5/69166: 61% mana crimson_chorus
3:05.128 aoe s arcane_explosion Fluffy_Pillow 38869.8/69166: 56% mana arcane_charge, crimson_chorus
3:06.415 aoe r arcane_missiles Fluffy_Pillow 35650.2/69166: 52% mana arcane_charge(2), clearcasting, crimson_chorus
3:08.457 aoe s arcane_explosion Fluffy_Pillow 38474.9/69166: 56% mana arcane_charge(2), crimson_chorus
3:09.745 aoe s arcane_explosion Fluffy_Pillow 35256.6/69166: 51% mana arcane_charge(3), crimson_chorus
3:11.031 aoe t arcane_barrage Fluffy_Pillow 32035.5/69166: 46% mana arcane_charge(4), crimson_chorus
3:12.319 aoe s arcane_explosion Fluffy_Pillow 36583.9/69166: 53% mana crimson_chorus(2)
3:13.606 aoe s arcane_explosion Fluffy_Pillow 33364.2/69166: 48% mana arcane_charge, crimson_chorus(2)
3:14.892 aoe s arcane_explosion Fluffy_Pillow 30143.1/69166: 44% mana arcane_charge(2), crimson_chorus(2)
3:16.178 aoe s arcane_explosion Fluffy_Pillow 26922.1/69166: 39% mana arcane_charge(3), crimson_chorus(2)
3:17.465 aoe t arcane_barrage Fluffy_Pillow 23702.4/69166: 34% mana arcane_charge(4), crimson_chorus(2)
3:18.751 aoe s arcane_explosion Fluffy_Pillow 28248.0/69166: 41% mana crimson_chorus(2)
3:20.040 aoe s arcane_explosion Fluffy_Pillow 25031.1/69166: 36% mana arcane_charge, crimson_chorus(2)
3:21.326 aoe s arcane_explosion Fluffy_Pillow 21810.0/69166: 32% mana arcane_charge(2), crimson_chorus(2)
3:22.613 aoe s arcane_explosion Fluffy_Pillow 18590.3/69166: 27% mana arcane_charge(3), crimson_chorus(3)
3:23.901 aoe t arcane_barrage Fluffy_Pillow 15372.1/69166: 22% mana arcane_charge(4), crimson_chorus(3)
3:25.189 aoe q arcane_orb Fluffy_Pillow 19920.4/69166: 29% mana crimson_chorus(3)
3:26.476 aoe t arcane_barrage Fluffy_Pillow 21200.7/69166: 31% mana arcane_charge(4), crimson_chorus(3)
3:27.764 aoe n touch_of_the_magi Fluffy_Pillow 25749.1/69166: 37% mana crimson_chorus(3)
3:29.051 aoe p rune_of_power Fluffy_Pillow 25029.4/69166: 36% mana arcane_charge(4), crimson_chorus(3)
3:30.338 aoe t arcane_barrage Fluffy_Pillow 26809.7/69166: 39% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:31.625 aoe s arcane_explosion Fluffy_Pillow 31356.7/69166: 45% mana rune_of_power, crimson_chorus(3)
3:32.911 aoe s arcane_explosion Fluffy_Pillow 28135.6/69166: 41% mana arcane_charge, rune_of_power
3:34.198 aoe s arcane_explosion Fluffy_Pillow 24915.9/69166: 36% mana arcane_charge(2), rune_of_power
3:35.484 aoe r arcane_missiles Fluffy_Pillow 21694.9/69166: 31% mana arcane_charge(3), clearcasting, rune_of_power
3:37.409 aoe s arcane_explosion Fluffy_Pillow 24357.7/69166: 35% mana arcane_charge(3), rune_of_power
3:38.695 aoe t arcane_barrage Fluffy_Pillow 21136.7/69166: 31% mana arcane_charge(4), rune_of_power
3:39.982 aoe s arcane_explosion Fluffy_Pillow 25683.6/69166: 37% mana rune_of_power
3:41.268 aoe s arcane_explosion Fluffy_Pillow 22462.6/69166: 32% mana arcane_charge, rune_of_power
3:42.554 aoe s arcane_explosion Fluffy_Pillow 19241.5/69166: 28% mana arcane_charge(2)
3:43.841 aoe s arcane_explosion Fluffy_Pillow 16021.9/69166: 23% mana arcane_charge(3)
3:45.127 aoe t arcane_barrage Fluffy_Pillow 12800.8/69166: 19% mana arcane_charge(4)
3:46.413 aoe q arcane_orb Fluffy_Pillow 17346.4/69166: 25% mana
3:47.700 aoe t arcane_barrage Fluffy_Pillow 18626.7/69166: 27% mana arcane_charge(4)
3:48.985 aoe s arcane_explosion Fluffy_Pillow 23170.9/69166: 34% mana
3:50.273 aoe s arcane_explosion Fluffy_Pillow 19952.6/69166: 29% mana arcane_charge
3:51.562 aoe r arcane_missiles Fluffy_Pillow 16735.7/69166: 24% mana arcane_charge(2), clearcasting
3:53.431 aoe s arcane_explosion Fluffy_Pillow 19321.1/69166: 28% mana arcane_charge(2)
3:54.720 aoe s arcane_explosion Fluffy_Pillow 16104.2/69166: 23% mana arcane_charge(3)
3:56.008 aoe t arcane_barrage Fluffy_Pillow 12885.9/69166: 19% mana arcane_charge(4)
3:57.294 aoe s arcane_explosion Fluffy_Pillow 17431.5/69166: 25% mana
3:58.579 aoe s arcane_explosion Fluffy_Pillow 14209.0/69166: 21% mana arcane_charge
3:59.867 aoe s arcane_explosion Fluffy_Pillow 10990.7/69166: 16% mana arcane_charge(2)
4:01.153 aoe r arcane_missiles Fluffy_Pillow 7769.7/69166: 11% mana arcane_charge(3), clearcasting
4:03.087 aoe s arcane_explosion Fluffy_Pillow 10445.0/69166: 15% mana arcane_charge(3), crimson_chorus
4:04.372 aoe r arcane_missiles Fluffy_Pillow 7222.6/69166: 10% mana arcane_charge(4), clearcasting, crimson_chorus
4:06.335 aoe t arcane_barrage Fluffy_Pillow 9938.0/69166: 14% mana arcane_charge(4), crimson_chorus
4:07.621 aoe q arcane_orb Fluffy_Pillow 14483.6/69166: 21% mana crimson_chorus
4:08.908 aoe t arcane_barrage Fluffy_Pillow 15763.9/69166: 23% mana arcane_charge(4), crimson_chorus
4:10.196 aoe s arcane_explosion Fluffy_Pillow 20312.2/69166: 29% mana crimson_chorus
4:11.483 aoe r arcane_missiles Fluffy_Pillow 17092.6/69166: 25% mana arcane_charge, clearcasting, crimson_chorus
4:13.523 aoe s arcane_explosion Fluffy_Pillow 19914.5/69166: 29% mana arcane_charge, crimson_chorus(2)
4:14.809 aoe n touch_of_the_magi Fluffy_Pillow 16693.5/69166: 24% mana arcane_charge(2), crimson_chorus(2)
4:16.093 aoe o arcane_power Fluffy_Pillow 15969.6/69166: 23% mana arcane_charge(4), crimson_chorus(2)
4:16.093 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 15969.6/69166: 23% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:16.093 aoe t arcane_barrage Fluffy_Pillow 15969.6/69166: 23% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.379 aoe s arcane_explosion Fluffy_Pillow 20515.2/69166: 30% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.666 aoe s arcane_explosion Fluffy_Pillow 19795.5/69166: 29% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.953 aoe s arcane_explosion Fluffy_Pillow 19075.9/69166: 28% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.238 aoe s arcane_explosion Fluffy_Pillow 18353.4/69166: 27% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.525 aoe t arcane_barrage Fluffy_Pillow 17633.8/69166: 25% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:23.811 shared_cds v use_mana_gem night_elf 22179.3/69166: 32% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:23.961 aoe s arcane_explosion Fluffy_Pillow 29303.4/69166: 42% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.247 aoe s arcane_explosion Fluffy_Pillow 28582.3/69166: 41% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:26.534 aoe s arcane_explosion Fluffy_Pillow 27862.7/69166: 40% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.822 aoe s arcane_explosion Fluffy_Pillow 27144.4/69166: 39% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:29.109 aoe p rune_of_power Fluffy_Pillow 26424.7/69166: 38% mana arcane_charge(4), arcane_power, crimson_chorus(3), gladiators_badge
4:30.397 aoe t arcane_barrage Fluffy_Pillow 28206.4/69166: 41% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:31.684 aoe q arcane_orb Fluffy_Pillow 32753.4/69166: 47% mana rune_of_power, crimson_chorus(3)
4:32.969 aoe t arcane_barrage Fluffy_Pillow 34030.9/69166: 49% mana arcane_charge(4), rune_of_power
4:34.255 aoe s arcane_explosion Fluffy_Pillow 38576.5/69166: 56% mana rune_of_power
4:35.541 aoe r arcane_missiles Fluffy_Pillow 35355.4/69166: 51% mana arcane_charge, clearcasting, rune_of_power
4:37.574 aoe s arcane_explosion Fluffy_Pillow 38167.7/69166: 55% mana arcane_charge, rune_of_power
4:38.860 aoe r arcane_missiles Fluffy_Pillow 34946.6/69166: 51% mana arcane_charge(2), clearcasting, rune_of_power
4:40.821 aoe s arcane_explosion Fluffy_Pillow 37659.3/69166: 54% mana arcane_charge(2), rune_of_power
4:42.108 aoe s arcane_explosion Fluffy_Pillow 34439.7/69166: 50% mana arcane_charge(3), rune_of_power
4:43.393 aoe t arcane_barrage Fluffy_Pillow 31217.2/69166: 45% mana arcane_charge(4)
4:44.679 aoe s arcane_explosion Fluffy_Pillow 35762.8/69166: 52% mana
4:45.964 aoe s arcane_explosion Fluffy_Pillow 32540.3/69166: 47% mana arcane_charge
4:47.251 aoe r arcane_missiles Fluffy_Pillow 29320.7/69166: 42% mana arcane_charge(2), clearcasting
4:49.170 aoe s arcane_explosion Fluffy_Pillow 31975.2/69166: 46% mana arcane_charge(2)
4:50.457 aoe s arcane_explosion Fluffy_Pillow 28755.6/69166: 42% mana arcane_charge(3)
4:51.744 aoe r arcane_missiles Fluffy_Pillow 25535.9/69166: 37% mana arcane_charge(4), clearcasting
4:53.636 aoe t arcane_barrage Fluffy_Pillow 28153.1/69166: 41% mana arcane_charge(4)
4:54.924 aoe q arcane_orb Fluffy_Pillow 32701.5/69166: 47% mana
4:56.210 aoe t arcane_barrage Fluffy_Pillow 33980.4/69166: 49% mana arcane_charge(4)
4:57.497 aoe s arcane_explosion Fluffy_Pillow 38527.4/69166: 56% mana
4:58.783 aoe s arcane_explosion Fluffy_Pillow 35306.3/69166: 51% mana arcane_charge
5:00.070 aoe s arcane_explosion Fluffy_Pillow 32086.6/69166: 46% mana arcane_charge(2)
5:01.356 aoe s arcane_explosion Fluffy_Pillow 28865.6/69166: 42% mana arcane_charge(3)

Stats

Level Bonus (60) Race Bonus (night_elf) Raid-Buffed Unbuffed Gear Amount
Strength 198 -2 196 196 0
Agility 306 2 308 308 0
Stamina 414 0 2027 1931 1517
Intellect 450 0 1795 1615 1089 (46)
Spirit 0 0 0 0 0
Health 40540 38620 0
Mana 69166 69166 0
Spell Power 1795 1615 0
Crit 15.34% 15.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="night_elf"
source=default
spec=arcane
level=60
race=night_elf
timeofday=day
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

no_race : 8797 dps, 4497 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8796.6 8796.6 15.6 / 0.178% 1076.8 / 12.2% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2041.8 1936.0 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
no_race 8797
Arcane Barrage 3708 42.2% 50.0 6.03sec 22299 18029 Direct 150.0 6324 12844 7444 17.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.04 149.96 0.00 0.00 1.2369 0.0000 1115936.43 1115936.43 0.00% 18029.22 18029.22
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.82% 124.20 90 160 6324.09 2172 30728 6318.65 5524 7101 785295 785295 0.00%
crit 17.18% 25.77 7 44 12843.96 4344 61455 12813.49 7573 20280 330642 330642 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.03
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 910 1820 1058 16.4%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1058.95 1058.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.63% 0.84 0 1 910.00 910 910 761.04 0 910 761 761 0.00%
crit 16.37% 0.16 0 1 1819.99 1820 1820 297.91 0 1820 298 298 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2898 32.9% 129.4 2.29sec 6728 5455 Direct 388.3 1899 3900 2243 17.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.44 388.31 0.00 0.00 1.2333 0.0000 870845.25 870845.25 0.00% 5455.43 5455.43
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.81% 321.55 238 409 1899.03 1452 3572 1899.42 1777 2035 610580 610580 0.00%
crit 17.19% 66.76 39 99 3899.93 2903 7144 3898.60 3255 4493 260265 260265 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.39
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1000 11.4% 24.4 11.89sec 12305 6475 Periodic 194.9 1311 2672 1543 17.1% 4.5%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.44 0.00 194.99 194.85 1.9005 0.2066 300755.16 300755.16 0.00% 6474.54 6474.54
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.91% 161.56 79 262 1311.13 1064 2618 1309.89 1123 1558 211804 211804 0.00%
crit 17.09% 33.30 10 67 2671.90 2128 5236 2671.35 2162 3384 88951 88951 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.49
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (592) 0.0% (6.7%) 12.7 24.43sec 13975 11270

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.74 0.00 0.00 0.00 1.2400 0.0000 0.00 0.00 0.00% 11270.46 11270.46

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.74
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 592 6.7% 38.2 24.43sec 4666 0 Direct 38.2 3955 8073 4666 17.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.15 38.15 0.00 0.00 0.0000 0.0000 178028.22 178028.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.73% 31.57 19 44 3954.82 2869 7059 3955.10 3254 4681 124828 124828 0.00%
crit 17.27% 6.59 1 15 8072.86 5738 14118 8105.31 5738 13319 53200 53200 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 13.9 1.82sec 513 0 Periodic 40.6 (42.5) 113 0 113 0.0% (0.0%) 4.4%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.89 0.00 40.58 40.58 0.0000 0.9864 4567.59 4567.59 0.00% 178.04 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.58 15 62 112.59 0 202 112.57 65 164 4568 4568 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 10.11sec 1331 0 Direct 1.9 1114 2230 1332 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.92 1.92 0.00 0.00 0.0000 0.0000 2558.08 2558.08 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.49% 1.55 0 3 1113.89 1093 1158 1041.37 0 1158 1723 1723 0.00%
crit 19.51% 0.37 0 3 2230.31 2185 2316 727.90 0 2316 836 836 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.3 14.46sec 530 0 Direct 20.3 452 904 530 17.4%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.33 20.33 0.00 0.00 0.0000 0.0000 10783.46 10783.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.64% 16.80 6 33 452.09 444 470 452.07 444 464 7595 7595 0.00%
crit 17.36% 3.53 0 11 903.51 887 941 886.16 0 941 3188 3188 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4091 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 102  / 14 0.2% 90.0 1.31sec 45 34 Direct 90.0 38 78 45 18.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4090.54 4090.54 0.00% 34.25 34.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.64% 73.48 62 84 38.24 30 46 38.23 37 40 2809 2809 0.00%
crit 18.36% 16.52 6 28 77.53 59 92 77.52 68 87 1281 1281 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (521) 0.0% (5.9%) 6.2 52.15sec 25242 19622

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19621.55 19621.55

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.22
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 521 5.9% 6.2 52.01sec 25242 0 Direct 18.6 8443 0 8443 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.20 18.56 0.00 0.00 0.0000 0.0000 156599.63 156599.63 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.56 15 21 8443.11 713 41716 8429.09 5212 11287 156600 156600 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17863.80
  • base_dd_max:17863.80
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
no_race
Arcane Power 2.9 127.21sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.88 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.88
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.48 0.00 2.87 0.00 4.2269 0.7103 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_race
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.48
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_race
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_race
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 50.37sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2376 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.07
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.60sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:no_race
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.8 136.7 6.0sec 1.6sec 4.6sec 78.03% 0.00% 3.0 (4.0) 0.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 16.8s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.5s

Stack Uptimes

  • arcane_charge_1:20.62%
  • arcane_charge_2:17.76%
  • arcane_charge_3:16.83%
  • arcane_charge_4:22.82%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.2sec 127.2sec 14.7sec 14.05% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 139.5s
  • trigger_min/max:120.0s / 139.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.05%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.6 0.0 11.8sec 11.8sec 1.3sec 10.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.49%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.05% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.8s
  • trigger_min/max:60.0s / 66.8s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.95%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 222.8sec 222.8sec 4.2sec 0.68% 0.00% 1.9 (1.9) 0.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:222.8s / 222.8s
  • trigger_min/max:222.8s / 222.8s
  • trigger_pct:100.00%
  • duration_min/max:1.0s / 4.3s

Stack Uptimes

  • evocation_1:0.69%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.9 0.0 87.0sec 87.0sec 14.6sec 19.02% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 139.5s
  • trigger_min/max:60.0s / 139.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.02%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 34.98% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 58.3s
  • trigger_min/max:12.1s / 58.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.98%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.91% 0.77% 5.53% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation219.36888.851353.268270.027150.505359.948
Rune of Power6.1820.00432.77638.93817.47776.980
Touch of the Magi4.9000.00028.57131.99015.38675.396
Arcane Power5.1140.00019.46614.9541.49229.513
Arcane Barrage3.5220.00414.234177.839135.656220.377
Arcane Orb4.2230.00016.70754.41831.64785.196

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
no_race
mana_regen Mana 1049.60 406023.29 69.76% 386.84 9432.56 2.27%
Evocation Mana 22.27 25017.12 4.30% 1123.23 0.00 0.00%
Mana Gem Mana 2.75 19005.32 3.27% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.03 132019.37 22.68% 2638.90 6390.13 4.62%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1935.95 2041.76 15825.8 37340.6 363.9 69165.7
Usage Type Count Total Avg RPE APR
no_race
arcane_explosion Mana 129.4 591208.1 4569.1 4567.6 1.5
arcane_orb Mana 12.7 5800.7 455.4 455.4 30.7
touch_of_the_magi Mana 6.2 15501.5 2499.8 2498.7 10.1

Statistics & Data Analysis

Fight Length
no_race Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
no_race Damage Per Second
Count 1118
Mean 8796.61
Minimum 8073.74
Maximum 9556.36
Spread ( max - min ) 1482.62
Range [ ( max - min ) / 2 * 100% ] 8.43%
Standard Deviation 266.5939
5th Percentile 8365.66
95th Percentile 9288.40
( 95th Percentile - 5th Percentile ) 922.74
Mean Distribution
Standard Deviation 7.9731
95.00% Confidence Interval ( 8780.98 - 8812.23 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3529
0.1 Scale Factor Error with Delta=300 607
0.05 Scale Factor Error with Delta=300 2427
0.01 Scale Factor Error with Delta=300 60672
Priority Target DPS
no_race Priority Target Damage Per Second
Count 1118
Mean 4496.59
Minimum 3859.36
Maximum 5076.59
Spread ( max - min ) 1217.24
Range [ ( max - min ) / 2 * 100% ] 13.54%
Standard Deviation 194.0512
5th Percentile 4190.88
95th Percentile 4837.58
( 95th Percentile - 5th Percentile ) 646.70
Mean Distribution
Standard Deviation 5.8036
95.00% Confidence Interval ( 4485.22 - 4507.97 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7155
0.1 Scale Factor Error with Delta=300 322
0.05 Scale Factor Error with Delta=300 1286
0.01 Scale Factor Error with Delta=300 32146
DPS(e)
no_race Damage Per Second (Effective)
Count 1118
Mean 8796.61
Minimum 8073.74
Maximum 9556.36
Spread ( max - min ) 1482.62
Range [ ( max - min ) / 2 * 100% ] 8.43%
Damage
no_race Damage
Count 1118
Mean 2641132.76
Minimum 1989964.86
Maximum 3234379.36
Spread ( max - min ) 1244414.49
Range [ ( max - min ) / 2 * 100% ] 23.56%
DTPS
no_race Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
no_race Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
no_race Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
no_race Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
no_race Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
no_race Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
no_raceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
no_race Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.22 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.88 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.07 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.74 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.49 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.39 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.03 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.48 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.92 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxtqtssrsstsrssrsptsssvstqtsrssstsssrstsssstqtsssstsssstssnxprtqtsssstsssstssrsrstqtsrssstsssrsrtqtsnortxsssstssssptqtsvrssstsrssstsssstqtsssstsrssstnpxtqtssssrtsssstsssstqtsssustsrsssrtnptqtsssstssssoxtsssstqtsssvstsssstsrssstnptqtsssrsrtss

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask no_race 69165.7/69166: 100% mana
Pre precombat U food no_race 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana
0:01.286 aoe o arcane_power Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, crimson_chorus
0:01.286 shared_cds w potion Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:01.286 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.286 aoe t arcane_barrage Fluffy_Pillow 66671.2/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.277 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.268 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.258 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.248 aoe s arcane_explosion Fluffy_Pillow 68035.2/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.238 aoe r arcane_missiles Fluffy_Pillow 66904.7/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.875 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.865 aoe s arcane_explosion Fluffy_Pillow 68035.2/69166: 98% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.855 aoe t arcane_barrage Fluffy_Pillow 66904.7/69166: 97% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.845 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.836 aoe r arcane_missiles Fluffy_Pillow 68036.6/69166: 98% mana bloodlust, arcane_charge, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.308 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.297 aoe s arcane_explosion Fluffy_Pillow 68033.8/69166: 98% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.288 aoe r arcane_missiles Fluffy_Pillow 66904.7/69166: 97% mana bloodlust, arcane_charge(3), arcane_power, clearcasting, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.788 aoe s arcane_explosion Fluffy_Pillow 68979.6/69166: 100% mana bloodlust, arcane_charge(3), crimson_chorus(2), potion_of_deathly_fixation
0:17.778 aoe p rune_of_power Fluffy_Pillow 65349.1/69166: 94% mana bloodlust, arcane_charge(4), crimson_chorus(2), potion_of_deathly_fixation
0:18.770 aoe t arcane_barrage Fluffy_Pillow 66721.4/69166: 96% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.762 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.752 aoe s arcane_explosion Fluffy_Pillow 65535.2/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.742 aoe s arcane_explosion Fluffy_Pillow 61904.7/69166: 90% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.732 shared_cds v use_mana_gem no_race 58274.2/69166: 84% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.732 aoe s arcane_explosion Fluffy_Pillow 65190.7/69166: 94% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.722 aoe t arcane_barrage Fluffy_Pillow 61560.2/69166: 89% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.712 aoe q arcane_orb Fluffy_Pillow 65696.3/69166: 95% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.704 aoe t arcane_barrage Fluffy_Pillow 66568.6/69166: 96% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.694 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3)
0:27.687 aoe r arcane_missiles Fluffy_Pillow 65539.3/69166: 95% mana bloodlust, arcane_charge, clearcasting, rune_of_power, crimson_chorus(3)
0:29.306 aoe s arcane_explosion Fluffy_Pillow 67778.9/69166: 98% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3)
0:30.295 aoe s arcane_explosion Fluffy_Pillow 64147.0/69166: 93% mana bloodlust, arcane_charge(2), rune_of_power
0:31.283 aoe s arcane_explosion Fluffy_Pillow 60513.7/69166: 87% mana bloodlust, arcane_charge(3)
0:32.273 aoe t arcane_barrage Fluffy_Pillow 56883.2/69166: 82% mana bloodlust, arcane_charge(4)
0:33.262 aoe s arcane_explosion Fluffy_Pillow 61018.0/69166: 88% mana bloodlust
0:34.254 aoe s arcane_explosion Fluffy_Pillow 57390.2/69166: 83% mana bloodlust, arcane_charge
0:35.245 aoe s arcane_explosion Fluffy_Pillow 53761.1/69166: 78% mana bloodlust, arcane_charge(2)
0:36.237 aoe r arcane_missiles Fluffy_Pillow 50133.3/69166: 72% mana bloodlust, arcane_charge(3), clearcasting
0:37.805 aoe s arcane_explosion Fluffy_Pillow 52302.3/69166: 76% mana bloodlust, arcane_charge(3)
0:38.795 aoe t arcane_barrage Fluffy_Pillow 48671.8/69166: 70% mana bloodlust, arcane_charge(4)
0:39.785 aoe s arcane_explosion Fluffy_Pillow 52807.9/69166: 76% mana bloodlust
0:40.778 aoe s arcane_explosion Fluffy_Pillow 49181.6/69166: 71% mana bloodlust, arcane_charge
0:41.769 aoe s arcane_explosion Fluffy_Pillow 45552.4/69166: 66% mana arcane_charge(2)
0:43.054 aoe s arcane_explosion Fluffy_Pillow 42330.0/69166: 61% mana arcane_charge(3)
0:44.341 aoe t arcane_barrage Fluffy_Pillow 39110.3/69166: 57% mana arcane_charge(4)
0:45.628 aoe q arcane_orb Fluffy_Pillow 43657.3/69166: 63% mana
0:46.917 aoe t arcane_barrage Fluffy_Pillow 44940.4/69166: 65% mana arcane_charge(4)
0:48.202 aoe s arcane_explosion Fluffy_Pillow 49484.6/69166: 72% mana
0:49.489 aoe s arcane_explosion Fluffy_Pillow 46264.9/69166: 67% mana arcane_charge
0:50.776 aoe s arcane_explosion Fluffy_Pillow 43045.2/69166: 62% mana arcane_charge(2)
0:52.062 aoe s arcane_explosion Fluffy_Pillow 39824.1/69166: 58% mana arcane_charge(3)
0:53.347 aoe t arcane_barrage Fluffy_Pillow 36601.7/69166: 53% mana arcane_charge(4)
0:54.633 aoe s arcane_explosion Fluffy_Pillow 41147.3/69166: 59% mana
0:55.921 aoe s arcane_explosion Fluffy_Pillow 37929.0/69166: 55% mana arcane_charge
0:57.207 aoe s arcane_explosion Fluffy_Pillow 34707.9/69166: 50% mana arcane_charge(2)
0:58.495 aoe s arcane_explosion Fluffy_Pillow 31489.6/69166: 46% mana arcane_charge(3)
0:59.782 aoe t arcane_barrage Fluffy_Pillow 28270.0/69166: 41% mana arcane_charge(4)
1:01.070 aoe s arcane_explosion Fluffy_Pillow 32818.3/69166: 47% mana crimson_chorus
1:02.357 aoe s arcane_explosion Fluffy_Pillow 29598.6/69166: 43% mana arcane_charge, crimson_chorus
1:03.644 aoe n touch_of_the_magi Fluffy_Pillow 26378.9/69166: 38% mana arcane_charge(2), crimson_chorus
1:04.931 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 25659.3/69166: 37% mana arcane_charge(4), clearcasting, crimson_chorus
1:04.931 aoe p rune_of_power Fluffy_Pillow 25659.3/69166: 37% mana arcane_charge(4), clearcasting, crimson_chorus, gladiators_badge
1:06.218 aoe r arcane_missiles Fluffy_Pillow 27439.6/69166: 40% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus, gladiators_badge
1:08.283 aoe t arcane_barrage Fluffy_Pillow 30296.1/69166: 44% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:09.568 aoe q arcane_orb Fluffy_Pillow 34840.3/69166: 50% mana rune_of_power, crimson_chorus, gladiators_badge
1:10.854 aoe t arcane_barrage Fluffy_Pillow 36119.3/69166: 52% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
1:12.142 aoe s arcane_explosion Fluffy_Pillow 40667.6/69166: 59% mana rune_of_power, crimson_chorus(2), gladiators_badge
1:13.431 aoe s arcane_explosion Fluffy_Pillow 37450.7/69166: 54% mana arcane_charge, rune_of_power, crimson_chorus(2), gladiators_badge
1:14.716 aoe s arcane_explosion Fluffy_Pillow 34228.3/69166: 49% mana arcane_charge(2), rune_of_power, crimson_chorus(2), gladiators_badge
1:16.003 aoe s arcane_explosion Fluffy_Pillow 31008.6/69166: 45% mana arcane_charge(3), rune_of_power, crimson_chorus(2), gladiators_badge
1:17.288 aoe t arcane_barrage Fluffy_Pillow 27786.1/69166: 40% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
1:18.574 aoe s arcane_explosion Fluffy_Pillow 32331.7/69166: 47% mana crimson_chorus(2), gladiators_badge
1:19.862 aoe s arcane_explosion Fluffy_Pillow 29113.4/69166: 42% mana arcane_charge, crimson_chorus(2), gladiators_badge
1:21.149 aoe s arcane_explosion Fluffy_Pillow 25893.8/69166: 37% mana arcane_charge(2), crimson_chorus(3)
1:22.436 aoe s arcane_explosion Fluffy_Pillow 22674.1/69166: 33% mana arcane_charge(3), crimson_chorus(3)
1:23.723 aoe t arcane_barrage Fluffy_Pillow 19454.4/69166: 28% mana arcane_charge(4), crimson_chorus(3)
1:25.009 aoe s arcane_explosion Fluffy_Pillow 24000.0/69166: 35% mana crimson_chorus(3)
1:26.294 aoe s arcane_explosion Fluffy_Pillow 20777.5/69166: 30% mana arcane_charge, crimson_chorus(3)
1:27.581 aoe r arcane_missiles Fluffy_Pillow 17557.9/69166: 25% mana arcane_charge(2), clearcasting, crimson_chorus(3)
1:29.585 aoe s arcane_explosion Fluffy_Pillow 20330.0/69166: 29% mana arcane_charge(2), crimson_chorus(3)
1:30.872 aoe r arcane_missiles Fluffy_Pillow 17110.3/69166: 25% mana arcane_charge(3), clearcasting
1:32.882 aoe s arcane_explosion Fluffy_Pillow 19890.8/69166: 29% mana arcane_charge(3)
1:34.168 aoe t arcane_barrage Fluffy_Pillow 16669.7/69166: 24% mana arcane_charge(4)
1:35.454 aoe q arcane_orb Fluffy_Pillow 21215.3/69166: 31% mana
1:36.741 aoe t arcane_barrage Fluffy_Pillow 22495.6/69166: 33% mana arcane_charge(4)
1:38.027 aoe s arcane_explosion Fluffy_Pillow 27041.2/69166: 39% mana
1:39.311 aoe r arcane_missiles Fluffy_Pillow 23817.4/69166: 34% mana arcane_charge, clearcasting
1:41.269 aoe s arcane_explosion Fluffy_Pillow 26525.9/69166: 38% mana arcane_charge
1:42.554 aoe s arcane_explosion Fluffy_Pillow 23303.5/69166: 34% mana arcane_charge(2)
1:43.842 aoe s arcane_explosion Fluffy_Pillow 20085.2/69166: 29% mana arcane_charge(3)
1:45.128 aoe t arcane_barrage Fluffy_Pillow 16864.1/69166: 24% mana arcane_charge(4)
1:46.414 aoe s arcane_explosion Fluffy_Pillow 21409.7/69166: 31% mana
1:47.701 aoe s arcane_explosion Fluffy_Pillow 18190.0/69166: 26% mana arcane_charge
1:48.986 aoe s arcane_explosion Fluffy_Pillow 14967.6/69166: 22% mana arcane_charge(2)
1:50.274 aoe r arcane_missiles Fluffy_Pillow 11749.3/69166: 17% mana arcane_charge(3), clearcasting
1:52.196 aoe s arcane_explosion Fluffy_Pillow 14408.0/69166: 21% mana arcane_charge(3)
1:53.482 aoe r arcane_missiles Fluffy_Pillow 11187.0/69166: 16% mana arcane_charge(4), clearcasting
1:55.536 aoe t arcane_barrage Fluffy_Pillow 14028.3/69166: 20% mana arcane_charge(4)
1:56.822 aoe q arcane_orb Fluffy_Pillow 18573.9/69166: 27% mana
1:58.108 aoe t arcane_barrage Fluffy_Pillow 19852.8/69166: 29% mana arcane_charge(4)
1:59.394 aoe s arcane_explosion Fluffy_Pillow 24398.4/69166: 35% mana
2:00.680 aoe n touch_of_the_magi Fluffy_Pillow 21177.3/69166: 31% mana arcane_charge, clearcasting
2:01.964 aoe o arcane_power Fluffy_Pillow 20453.5/69166: 30% mana arcane_charge(4), clearcasting
2:01.964 aoe r arcane_missiles Fluffy_Pillow 20453.5/69166: 30% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
2:03.841 aoe t arcane_barrage Fluffy_Pillow 23050.0/69166: 33% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:05.128 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 27596.9/69166: 40% mana arcane_power, rune_of_power, crimson_chorus
2:05.128 aoe s arcane_explosion Fluffy_Pillow 27596.9/69166: 40% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:06.414 aoe s arcane_explosion Fluffy_Pillow 26875.9/69166: 39% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:07.699 aoe s arcane_explosion Fluffy_Pillow 26153.4/69166: 38% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:08.987 aoe s arcane_explosion Fluffy_Pillow 25435.1/69166: 37% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:10.275 aoe t arcane_barrage Fluffy_Pillow 24716.8/69166: 36% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:11.560 aoe s arcane_explosion Fluffy_Pillow 29261.0/69166: 42% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:12.847 aoe s arcane_explosion Fluffy_Pillow 28541.4/69166: 41% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.134 aoe s arcane_explosion Fluffy_Pillow 27821.7/69166: 40% mana arcane_charge(2), arcane_power, crimson_chorus(2), gladiators_badge
2:15.421 aoe s arcane_explosion Fluffy_Pillow 27102.0/69166: 39% mana arcane_charge(3), arcane_power, crimson_chorus(2), gladiators_badge
2:16.709 aoe p rune_of_power Fluffy_Pillow 26383.7/69166: 38% mana arcane_charge(4), arcane_power, crimson_chorus(2), gladiators_badge
2:17.996 aoe t arcane_barrage Fluffy_Pillow 28164.0/69166: 41% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
2:19.285 aoe q arcane_orb Fluffy_Pillow 32713.8/69166: 47% mana rune_of_power, crimson_chorus(2), gladiators_badge
2:20.573 aoe t arcane_barrage Fluffy_Pillow 33995.5/69166: 49% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
2:21.859 aoe s arcane_explosion Fluffy_Pillow 38541.0/69166: 56% mana rune_of_power, crimson_chorus(2)
2:23.146 shared_cds v use_mana_gem no_race 35321.4/69166: 51% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(3)
2:23.146 aoe r arcane_missiles Fluffy_Pillow 42237.9/69166: 61% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(3)
2:25.112 aoe s arcane_explosion Fluffy_Pillow 44957.5/69166: 65% mana arcane_charge, rune_of_power, crimson_chorus(3)
2:26.399 aoe s arcane_explosion Fluffy_Pillow 41737.9/69166: 60% mana arcane_charge(2), rune_of_power, crimson_chorus(3)
2:27.686 aoe s arcane_explosion Fluffy_Pillow 38518.2/69166: 56% mana arcane_charge(3), rune_of_power, crimson_chorus(3)
2:28.973 aoe t arcane_barrage Fluffy_Pillow 35298.5/69166: 51% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
2:30.260 aoe s arcane_explosion Fluffy_Pillow 39845.5/69166: 58% mana crimson_chorus(3)
2:31.548 aoe r arcane_missiles Fluffy_Pillow 36627.2/69166: 53% mana arcane_charge, clearcasting, crimson_chorus(3)
2:33.530 aoe s arcane_explosion Fluffy_Pillow 39368.9/69166: 57% mana arcane_charge
2:34.817 aoe s arcane_explosion Fluffy_Pillow 36149.2/69166: 52% mana arcane_charge(2)
2:36.103 aoe s arcane_explosion Fluffy_Pillow 32928.2/69166: 48% mana arcane_charge(3)
2:37.388 aoe t arcane_barrage Fluffy_Pillow 29705.7/69166: 43% mana arcane_charge(4)
2:38.674 aoe s arcane_explosion Fluffy_Pillow 34251.3/69166: 50% mana
2:39.961 aoe s arcane_explosion Fluffy_Pillow 31031.6/69166: 45% mana arcane_charge
2:41.248 aoe s arcane_explosion Fluffy_Pillow 27812.0/69166: 40% mana arcane_charge(2)
2:42.534 aoe s arcane_explosion Fluffy_Pillow 24590.9/69166: 36% mana arcane_charge(3)
2:43.823 aoe t arcane_barrage Fluffy_Pillow 21374.0/69166: 31% mana arcane_charge(4)
2:45.110 aoe q arcane_orb Fluffy_Pillow 25920.9/69166: 37% mana
2:46.397 aoe t arcane_barrage Fluffy_Pillow 27201.3/69166: 39% mana arcane_charge(4)
2:47.685 aoe s arcane_explosion Fluffy_Pillow 31749.6/69166: 46% mana
2:48.973 aoe s arcane_explosion Fluffy_Pillow 28531.3/69166: 41% mana arcane_charge
2:50.259 aoe s arcane_explosion Fluffy_Pillow 25310.3/69166: 37% mana arcane_charge(2)
2:51.548 aoe s arcane_explosion Fluffy_Pillow 22093.4/69166: 32% mana arcane_charge(3)
2:52.837 aoe t arcane_barrage Fluffy_Pillow 18876.4/69166: 27% mana arcane_charge(4)
2:54.124 aoe s arcane_explosion Fluffy_Pillow 23423.4/69166: 34% mana
2:55.412 aoe r arcane_missiles Fluffy_Pillow 20205.1/69166: 29% mana arcane_charge, clearcasting
2:57.365 aoe s arcane_explosion Fluffy_Pillow 22906.7/69166: 33% mana arcane_charge
2:58.653 aoe s arcane_explosion Fluffy_Pillow 19688.4/69166: 28% mana arcane_charge(2)
2:59.939 aoe s arcane_explosion Fluffy_Pillow 16467.4/69166: 24% mana arcane_charge(3)
3:01.226 aoe t arcane_barrage Fluffy_Pillow 13247.7/69166: 19% mana arcane_charge(4)
3:02.512 aoe n touch_of_the_magi Fluffy_Pillow 17793.3/69166: 26% mana
3:03.796 aoe p rune_of_power Fluffy_Pillow 17069.4/69166: 25% mana arcane_charge(4)
3:05.083 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 18849.8/69166: 27% mana arcane_charge(4), rune_of_power
3:05.128 aoe t arcane_barrage Fluffy_Pillow 18912.0/69166: 27% mana arcane_charge(4), rune_of_power, gladiators_badge
3:06.414 aoe q arcane_orb Fluffy_Pillow 23457.6/69166: 34% mana rune_of_power, crimson_chorus, gladiators_badge
3:07.699 aoe t arcane_barrage Fluffy_Pillow 24735.1/69166: 36% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
3:08.985 aoe s arcane_explosion Fluffy_Pillow 29280.7/69166: 42% mana rune_of_power, crimson_chorus, gladiators_badge
3:10.270 aoe s arcane_explosion Fluffy_Pillow 26058.3/69166: 38% mana arcane_charge, rune_of_power, crimson_chorus, gladiators_badge
3:11.556 aoe s arcane_explosion Fluffy_Pillow 22837.2/69166: 33% mana arcane_charge(2), rune_of_power, crimson_chorus, gladiators_badge
3:12.843 aoe s arcane_explosion Fluffy_Pillow 19617.5/69166: 28% mana arcane_charge(3), rune_of_power, crimson_chorus, gladiators_badge
3:14.128 aoe r arcane_missiles Fluffy_Pillow 16395.1/69166: 24% mana arcane_charge(4), clearcasting, rune_of_power, crimson_chorus, gladiators_badge
3:16.135 aoe t arcane_barrage Fluffy_Pillow 19171.4/69166: 28% mana arcane_charge(4), rune_of_power, crimson_chorus(2), gladiators_badge
3:17.421 aoe s arcane_explosion Fluffy_Pillow 23717.0/69166: 34% mana crimson_chorus(2), gladiators_badge
3:18.707 aoe s arcane_explosion Fluffy_Pillow 20495.9/69166: 30% mana arcane_charge, crimson_chorus(2), gladiators_badge
3:19.994 aoe s arcane_explosion Fluffy_Pillow 17276.3/69166: 25% mana arcane_charge(2), crimson_chorus(2), gladiators_badge
3:21.281 aoe s arcane_explosion Fluffy_Pillow 14056.6/69166: 20% mana arcane_charge(3), crimson_chorus(2)
3:22.566 aoe t arcane_barrage Fluffy_Pillow 10834.1/69166: 16% mana arcane_charge(4), crimson_chorus(2)
3:23.854 aoe s arcane_explosion Fluffy_Pillow 15382.5/69166: 22% mana crimson_chorus(2)
3:25.139 aoe s arcane_explosion Fluffy_Pillow 12160.0/69166: 18% mana arcane_charge, crimson_chorus(2)
3:26.426 aoe s arcane_explosion Fluffy_Pillow 8940.4/69166: 13% mana arcane_charge(2), crimson_chorus(3)
3:27.713 aoe s arcane_explosion Fluffy_Pillow 5720.7/69166: 8% mana arcane_charge(3), crimson_chorus(3)
3:29.000 aoe t arcane_barrage Fluffy_Pillow 2501.0/69166: 4% mana arcane_charge(4), crimson_chorus(3)
3:30.286 aoe q arcane_orb Fluffy_Pillow 7046.6/69166: 10% mana crimson_chorus(3)
3:31.572 aoe t arcane_barrage Fluffy_Pillow 8325.5/69166: 12% mana arcane_charge(4), crimson_chorus(3)
3:32.858 aoe s arcane_explosion Fluffy_Pillow 12871.1/69166: 19% mana crimson_chorus(3)
3:34.145 aoe s arcane_explosion Fluffy_Pillow 9651.4/69166: 14% mana arcane_charge, crimson_chorus(3)
3:35.431 aoe s arcane_explosion Fluffy_Pillow 6430.4/69166: 9% mana arcane_charge(2), crimson_chorus(3)
3:36.717 aoe u evocation no_race 3209.3/69166: 5% mana arcane_charge(3)
3:40.992 aoe s arcane_explosion Fluffy_Pillow 61958.9/69166: 90% mana arcane_charge(3)
3:42.279 aoe t arcane_barrage Fluffy_Pillow 58739.2/69166: 85% mana arcane_charge(4)
3:43.565 aoe s arcane_explosion Fluffy_Pillow 63284.8/69166: 91% mana
3:44.851 aoe r arcane_missiles Fluffy_Pillow 60063.7/69166: 87% mana arcane_charge, clearcasting
3:46.835 aoe s arcane_explosion Fluffy_Pillow 62808.2/69166: 91% mana arcane_charge
3:48.122 aoe s arcane_explosion Fluffy_Pillow 59588.5/69166: 86% mana arcane_charge(2)
3:49.408 aoe s arcane_explosion Fluffy_Pillow 56367.5/69166: 81% mana arcane_charge(3)
3:50.694 aoe r arcane_missiles Fluffy_Pillow 53146.4/69166: 77% mana arcane_charge(4), clearcasting
3:52.695 aoe t arcane_barrage Fluffy_Pillow 55914.4/69166: 81% mana arcane_charge(4)
3:53.982 aoe n touch_of_the_magi Fluffy_Pillow 60461.4/69166: 87% mana
3:55.271 aoe p rune_of_power Fluffy_Pillow 59744.5/69166: 86% mana arcane_charge(4)
3:56.558 aoe t arcane_barrage Fluffy_Pillow 61524.8/69166: 89% mana arcane_charge(4), rune_of_power
3:57.843 aoe q arcane_orb Fluffy_Pillow 66069.0/69166: 96% mana rune_of_power
3:59.130 aoe t arcane_barrage Fluffy_Pillow 67349.3/69166: 97% mana arcane_charge(4), rune_of_power
4:00.416 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana rune_of_power
4:01.704 aoe s arcane_explosion Fluffy_Pillow 65947.4/69166: 95% mana arcane_charge, rune_of_power
4:02.990 aoe s arcane_explosion Fluffy_Pillow 62726.4/69166: 91% mana arcane_charge(2), rune_of_power
4:04.278 aoe s arcane_explosion Fluffy_Pillow 59508.1/69166: 86% mana arcane_charge(3), rune_of_power
4:05.565 aoe t arcane_barrage Fluffy_Pillow 56288.4/69166: 81% mana arcane_charge(4), rune_of_power
4:06.853 aoe s arcane_explosion Fluffy_Pillow 60836.7/69166: 88% mana rune_of_power, crimson_chorus
4:08.141 aoe s arcane_explosion Fluffy_Pillow 57618.4/69166: 83% mana arcane_charge, rune_of_power, crimson_chorus
4:09.428 aoe s arcane_explosion Fluffy_Pillow 54398.8/69166: 79% mana arcane_charge(2), crimson_chorus
4:10.713 aoe s arcane_explosion Fluffy_Pillow 51176.3/69166: 74% mana arcane_charge(3), crimson_chorus
4:12.001 aoe o arcane_power Fluffy_Pillow 47958.0/69166: 69% mana arcane_charge(4), crimson_chorus
4:12.001 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 47958.0/69166: 69% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
4:12.001 aoe t arcane_barrage Fluffy_Pillow 47958.0/69166: 69% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:13.288 aoe s arcane_explosion Fluffy_Pillow 52505.0/69166: 76% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:14.574 aoe s arcane_explosion Fluffy_Pillow 51783.9/69166: 75% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus, gladiators_badge
4:15.861 aoe s arcane_explosion Fluffy_Pillow 51064.3/69166: 74% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.147 aoe s arcane_explosion Fluffy_Pillow 50343.2/69166: 73% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.435 aoe t arcane_barrage Fluffy_Pillow 49624.9/69166: 72% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.722 aoe q arcane_orb Fluffy_Pillow 54171.9/69166: 78% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.008 aoe t arcane_barrage Fluffy_Pillow 55700.8/69166: 81% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.294 aoe s arcane_explosion Fluffy_Pillow 60246.4/69166: 87% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:23.581 aoe s arcane_explosion Fluffy_Pillow 59526.7/69166: 86% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:24.866 aoe s arcane_explosion Fluffy_Pillow 58804.3/69166: 85% mana arcane_charge(2), arcane_power, crimson_chorus(2), gladiators_badge
4:26.152 shared_cds v use_mana_gem no_race 58083.2/69166: 84% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:26.152 aoe s arcane_explosion Fluffy_Pillow 64999.8/69166: 94% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
4:27.440 aoe t arcane_barrage Fluffy_Pillow 64281.5/69166: 93% mana arcane_charge(4), crimson_chorus(3)
4:28.727 aoe s arcane_explosion Fluffy_Pillow 68828.4/69166: 100% mana crimson_chorus(3)
4:30.014 aoe s arcane_explosion Fluffy_Pillow 65608.8/69166: 95% mana arcane_charge, crimson_chorus(3)
4:31.300 aoe s arcane_explosion Fluffy_Pillow 62387.7/69166: 90% mana arcane_charge(2), crimson_chorus(3)
4:32.588 aoe s arcane_explosion Fluffy_Pillow 59169.4/69166: 86% mana arcane_charge(3), crimson_chorus(3)
4:33.872 aoe t arcane_barrage Fluffy_Pillow 55945.6/69166: 81% mana arcane_charge(4), crimson_chorus(3)
4:35.158 aoe s arcane_explosion Fluffy_Pillow 60491.2/69166: 87% mana crimson_chorus(3)
4:36.444 aoe r arcane_missiles Fluffy_Pillow 57270.1/69166: 83% mana arcane_charge, clearcasting
4:38.403 aoe s arcane_explosion Fluffy_Pillow 59980.0/69166: 87% mana arcane_charge
4:39.691 aoe s arcane_explosion Fluffy_Pillow 56761.7/69166: 82% mana arcane_charge(2)
4:40.977 aoe s arcane_explosion Fluffy_Pillow 53540.7/69166: 77% mana arcane_charge(3)
4:42.263 aoe t arcane_barrage Fluffy_Pillow 50319.6/69166: 73% mana arcane_charge(4)
4:43.549 aoe n touch_of_the_magi Fluffy_Pillow 54865.2/69166: 79% mana
4:44.835 aoe p rune_of_power Fluffy_Pillow 54144.1/69166: 78% mana arcane_charge(4)
4:46.121 aoe t arcane_barrage Fluffy_Pillow 55923.1/69166: 81% mana arcane_charge(4), rune_of_power
4:47.407 aoe q arcane_orb Fluffy_Pillow 60468.6/69166: 87% mana rune_of_power
4:48.693 aoe t arcane_barrage Fluffy_Pillow 61747.6/69166: 89% mana arcane_charge(4), rune_of_power
4:49.979 aoe s arcane_explosion Fluffy_Pillow 66293.1/69166: 96% mana rune_of_power
4:51.266 aoe s arcane_explosion Fluffy_Pillow 63073.5/69166: 91% mana arcane_charge, rune_of_power
4:52.553 aoe s arcane_explosion Fluffy_Pillow 59853.8/69166: 87% mana arcane_charge(2), rune_of_power
4:53.841 aoe r arcane_missiles Fluffy_Pillow 56635.5/69166: 82% mana arcane_charge(3), clearcasting, rune_of_power
4:55.756 aoe s arcane_explosion Fluffy_Pillow 59284.6/69166: 86% mana arcane_charge(3), rune_of_power
4:57.043 aoe r arcane_missiles Fluffy_Pillow 56064.9/69166: 81% mana arcane_charge(4), clearcasting, rune_of_power
4:58.943 aoe t arcane_barrage Fluffy_Pillow 58693.2/69166: 85% mana arcane_charge(4)
5:00.230 aoe s arcane_explosion Fluffy_Pillow 63240.1/69166: 91% mana
5:01.519 aoe s arcane_explosion Fluffy_Pillow 60023.2/69166: 87% mana arcane_charge

Stats

Level Bonus (60) Race Bonus (none) Raid-Buffed Unbuffed Gear Amount
Strength 198 0 198 198 0
Agility 306 0 306 306 0
Stamina 414 0 2027 1931 1517
Intellect 450 0 1795 1615 1089 (46)
Spirit 0 0 0 0 0
Health 40540 38620 0
Mana 69166 69166 0
Spell Power 1795 1615 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="no_race"
source=default
spec=arcane
level=60
race=none
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

pandaren : 8910 dps, 4560 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8910.3 8910.3 15.4 / 0.173% 1032.8 / 11.6% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2042.7 1940.0 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
pandaren 8910
Arcane Barrage 3760 42.2% 50.0 6.04sec 22616 18283 Direct 149.9 6374 13167 7548 17.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.04 149.92 0.00 0.00 1.2370 0.0000 1131623.44 1131623.44 0.00% 18283.25 18283.25
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.71% 124.01 86 158 6374.16 2200 31068 6365.75 5516 7318 790239 790239 0.00%
crit 17.29% 25.92 10 43 13166.83 4400 62137 13140.85 7945 20405 341384 341384 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.03
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 922 1843 1068 15.7%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1066.75 1066.75 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 84.26% 0.84 0 1 921.66 922 922 776.57 0 922 777 777 0.00%
crit 15.74% 0.16 0 1 1843.31 1843 1843 290.18 0 1843 290 290 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2930 32.9% 129.4 2.30sec 6804 5516 Direct 388.3 1922 3940 2268 17.1%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.44 388.31 0.00 0.00 1.2333 0.0000 880625.48 880625.48 0.00% 5516.39 5516.39
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.86% 321.75 235 413 1922.25 1470 3611 1922.50 1788 2043 618429 618429 0.00%
crit 17.14% 66.56 39 98 3939.69 2941 7223 3939.02 3389 4491 262197 262197 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.43
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1012 11.4% 24.4 11.75sec 12485 6574 Periodic 194.3 1332 2710 1566 17.0% 4.4%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.37 0.00 194.46 194.33 1.8992 0.2065 304260.99 304260.99 0.00% 6574.21 6574.21
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.98% 161.26 79 251 1331.83 1078 2647 1331.12 1128 1602 214694 214694 0.00%
crit 17.02% 33.07 6 63 2710.05 2155 5294 2706.11 2171 3560 89567 89567 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.37
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (600) 0.0% (6.7%) 12.7 24.31sec 14137 11401

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.75 0.00 0.00 0.00 1.2401 0.0000 0.00 0.00 0.00% 11400.55 11400.55

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.75
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 600 6.7% 38.2 24.31sec 4721 0 Direct 38.2 3999 8203 4719 17.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.17 38.17 0.00 0.00 0.0000 0.0000 180185.68 180185.68 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.87% 31.63 20 44 3999.46 2906 7137 3999.73 3206 4620 126509 126509 0.00%
crit 17.13% 6.54 0 16 8203.44 5812 14274 8199.96 0 13736 53676 53676 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 13.8 1.76sec 515 0 Periodic 40.9 (42.8) 112 0 112 0.0% (0.0%) 4.5%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.85 0.00 40.93 40.93 0.0000 0.9866 4594.18 4594.18 0.00% 176.68 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.93 16 65 112.16 0 202 112.25 69 169 4594 4594 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 9.35sec 1334 0 Direct 1.9 1114 2226 1334 19.8%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.91 1.91 0.00 0.00 0.0000 0.0000 2541.56 2541.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.23% 1.53 0 4 1114.11 1093 1158 1043.52 0 1158 1703 1703 0.00%
crit 19.77% 0.38 0 3 2226.12 2185 2316 762.61 0 2316 838 838 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.3 14.29sec 530 0 Direct 20.3 452 904 530 17.2%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.32 20.32 0.00 0.00 0.0000 0.0000 10764.29 10764.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.83% 16.83 6 29 451.98 444 470 451.93 444 463 7609 7609 0.00%
crit 17.17% 3.49 0 12 904.33 887 941 873.05 0 941 3156 3156 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4141 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 104  / 14 0.2% 90.0 1.31sec 46 35 Direct 90.0 39 79 46 18.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4140.80 4140.80 0.00% 34.67 34.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.64% 73.48 58 83 38.69 30 46 38.69 38 40 2843 2843 0.00%
crit 18.36% 16.52 7 32 78.55 60 93 78.59 68 88 1298 1298 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (531) 0.0% (6.0%) 6.2 52.06sec 25674 19958

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19957.61 19957.61

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 531 6.0% 6.2 51.97sec 25674 0 Direct 18.6 8592 0 8592 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.57 0.00 0.00 0.0000 0.0000 159461.30 159461.30 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.57 15 21 8591.52 218 40416 8579.92 5528 11940 159461 159461 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14170.07
  • base_dd_max:14170.07
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
pandaren
Arcane Power 2.9 127.09sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.52 0.00 3.07 0.00 4.2168 0.7100 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:pandaren
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.52
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:pandaren
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:pandaren
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.37sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2376 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.08
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.41sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:pandaren
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.8 136.7 6.0sec 1.6sec 4.6sec 78.01% 0.00% 2.9 (4.0) 0.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 16.1s
  • trigger_min/max:0.0s / 7.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:20.55%
  • arcane_charge_2:17.64%
  • arcane_charge_3:16.92%
  • arcane_charge_4:22.90%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.3sec 127.3sec 14.7sec 14.05% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 141.1s
  • trigger_min/max:120.0s / 141.1s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 15.0s

Stack Uptimes

  • arcane_power_1:14.05%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.5 0.0 11.9sec 11.9sec 1.3sec 10.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.48%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.02% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.5s
  • trigger_min/max:60.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.93%
  • crimson_chorus_2:17.33%
  • crimson_chorus_3:16.76%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 219.5sec 219.5sec 4.2sec 0.73% 0.00% 2.0 (2.0) 0.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:219.5s / 219.5s
  • trigger_min/max:219.5s / 219.5s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:0.73%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.9 0.0 86.7sec 86.7sec 14.6sec 19.06% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 141.1s
  • trigger_min/max:60.0s / 141.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.06%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 35.02% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 62.3s
  • trigger_min/max:12.1s / 62.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.02%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.96% 0.76% 5.17% 0.9s 0.0s 4.5s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation222.93388.430352.871267.846155.161359.985
Rune of Power6.1300.00434.68838.67617.38579.700
Touch of the Magi4.8650.00026.15631.76915.21878.116
Arcane Power5.1820.00021.08915.1001.63029.368
Arcane Barrage3.5190.00412.245177.827138.287217.064
Arcane Orb4.1950.00017.91054.03028.90988.030

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
pandaren
mana_regen Mana 1048.53 405727.37 69.52% 386.95 9748.54 2.35%
Evocation Mana 24.19 27171.61 4.66% 1123.36 0.00 0.00%
Mana Gem Mana 2.73 18901.64 3.24% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.03 131831.17 22.59% 2635.04 6583.21 4.76%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1939.98 2042.73 16272.3 38261.3 531.3 69165.7
Usage Type Count Total Avg RPE APR
pandaren
arcane_explosion Mana 129.4 591684.3 4571.3 4571.3 1.5
arcane_orb Mana 12.7 5800.5 455.1 455.1 31.1
touch_of_the_magi Mana 6.2 15512.6 2498.8 2497.6 10.3

Statistics & Data Analysis

Fight Length
pandaren Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
pandaren Damage Per Second
Count 1118
Mean 8910.33
Minimum 8100.48
Maximum 9757.77
Spread ( max - min ) 1657.29
Range [ ( max - min ) / 2 * 100% ] 9.30%
Standard Deviation 263.4576
5th Percentile 8489.12
95th Percentile 9354.91
( 95th Percentile - 5th Percentile ) 865.79
Mean Distribution
Standard Deviation 7.8793
95.00% Confidence Interval ( 8894.88 - 8925.77 )
Normalized 95.00% Confidence Interval ( 99.83% - 100.17% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 34
0.1% Error 3359
0.1 Scale Factor Error with Delta=300 593
0.05 Scale Factor Error with Delta=300 2371
0.01 Scale Factor Error with Delta=300 59253
Priority Target DPS
pandaren Priority Target Damage Per Second
Count 1118
Mean 4559.85
Minimum 3902.31
Maximum 5194.99
Spread ( max - min ) 1292.68
Range [ ( max - min ) / 2 * 100% ] 14.17%
Standard Deviation 195.0006
5th Percentile 4247.29
95th Percentile 4902.75
( 95th Percentile - 5th Percentile ) 655.46
Mean Distribution
Standard Deviation 5.8320
95.00% Confidence Interval ( 4548.42 - 4571.28 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 71
0.1% Error 7026
0.1 Scale Factor Error with Delta=300 325
0.05 Scale Factor Error with Delta=300 1299
0.01 Scale Factor Error with Delta=300 32461
DPS(e)
pandaren Damage Per Second (Effective)
Count 1118
Mean 8910.33
Minimum 8100.48
Maximum 9757.77
Spread ( max - min ) 1657.29
Range [ ( max - min ) / 2 * 100% ] 9.30%
Damage
pandaren Damage
Count 1118
Mean 2675123.66
Minimum 2006042.02
Maximum 3295966.85
Spread ( max - min ) 1289924.83
Range [ ( max - min ) / 2 * 100% ] 24.11%
DTPS
pandaren Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
pandaren Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
pandaren Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
pandaren Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
pandaren Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
pandaren Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
pandarenTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
pandaren Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.08 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.75 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.37 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.43 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.03 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.52 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.94 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxrtqtsssstssssptsrsssvtsssstqtsssstsssrsrtsrssstqtsssstnxptsssstsssrsrtqtsrssstsssstsssstqtnptsrssstssrssoxtqtsssstssssvtsssrstqtnptsrssstsrssrstqtssssrtsssstsrssstnptqtsrssstssrssrtqtsrssstssssrtssnoxtqrtsssstvssssptsrsssrtqtsrsrsstsrssst

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask pandaren 69165.7/69166: 100% mana
Pre precombat U food pandaren 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana clearcasting
0:01.289 aoe o arcane_power Fluffy_Pillow 66675.4/69166: 96% mana bloodlust, clearcasting, crimson_chorus
0:01.289 shared_cds w potion Fluffy_Pillow 66675.4/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus
0:01.289 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66675.4/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.289 aoe r arcane_missiles Fluffy_Pillow 66675.4/69166: 96% mana bloodlust, arcane_power, clearcasting, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.798 aoe t arcane_barrage Fluffy_Pillow 68762.8/69166: 99% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.786 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.775 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.767 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.756 aoe s arcane_explosion Fluffy_Pillow 68033.8/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.745 aoe s arcane_explosion Fluffy_Pillow 66901.9/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.734 aoe s arcane_explosion Fluffy_Pillow 65770.0/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.723 aoe t arcane_barrage Fluffy_Pillow 64638.1/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.713 aoe s arcane_explosion Fluffy_Pillow 68774.2/69166: 99% mana bloodlust, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.705 aoe s arcane_explosion Fluffy_Pillow 67646.5/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.693 aoe s arcane_explosion Fluffy_Pillow 66513.2/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.683 aoe s arcane_explosion Fluffy_Pillow 65382.7/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.673 aoe p rune_of_power Fluffy_Pillow 64252.1/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.664 aoe t arcane_barrage Fluffy_Pillow 65623.0/69166: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.653 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:17.645 aoe r arcane_missiles Fluffy_Pillow 65538.0/69166: 95% mana bloodlust, arcane_charge, clearcasting, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:19.186 aoe s arcane_explosion Fluffy_Pillow 67669.6/69166: 98% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.177 aoe s arcane_explosion Fluffy_Pillow 64040.5/69166: 93% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.168 aoe s arcane_explosion Fluffy_Pillow 60411.4/69166: 87% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.159 shared_cds v use_mana_gem pandaren 56782.2/69166: 82% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.159 aoe t arcane_barrage Fluffy_Pillow 63698.8/69166: 92% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.150 aoe s arcane_explosion Fluffy_Pillow 67836.3/69166: 98% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.142 aoe s arcane_explosion Fluffy_Pillow 64208.6/69166: 93% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.132 aoe s arcane_explosion Fluffy_Pillow 60578.0/69166: 88% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.122 aoe s arcane_explosion Fluffy_Pillow 56947.5/69166: 82% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:27.111 aoe t arcane_barrage Fluffy_Pillow 53315.6/69166: 77% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3)
0:28.103 aoe q arcane_orb Fluffy_Pillow 57454.5/69166: 83% mana bloodlust, crimson_chorus(3)
0:29.093 aoe t arcane_barrage Fluffy_Pillow 58324.0/69166: 84% mana bloodlust, arcane_charge(4), crimson_chorus(3)
0:30.084 aoe s arcane_explosion Fluffy_Pillow 62461.5/69166: 90% mana bloodlust
0:31.073 aoe s arcane_explosion Fluffy_Pillow 58829.6/69166: 85% mana bloodlust, arcane_charge
0:32.063 aoe s arcane_explosion Fluffy_Pillow 55199.0/69166: 80% mana bloodlust, arcane_charge(2)
0:33.053 aoe s arcane_explosion Fluffy_Pillow 51568.5/69166: 75% mana bloodlust, arcane_charge(3)
0:34.044 aoe t arcane_barrage Fluffy_Pillow 47939.4/69166: 69% mana bloodlust, arcane_charge(4)
0:35.036 aoe s arcane_explosion Fluffy_Pillow 52078.3/69166: 75% mana bloodlust
0:36.028 aoe s arcane_explosion Fluffy_Pillow 48450.5/69166: 70% mana bloodlust, arcane_charge
0:37.019 aoe s arcane_explosion Fluffy_Pillow 44821.4/69166: 65% mana bloodlust, arcane_charge(2)
0:38.009 aoe r arcane_missiles Fluffy_Pillow 41190.9/69166: 60% mana bloodlust, arcane_charge(3), clearcasting
0:39.589 aoe s arcane_explosion Fluffy_Pillow 43376.5/69166: 63% mana bloodlust, arcane_charge(3)
0:40.579 aoe r arcane_missiles Fluffy_Pillow 39746.0/69166: 57% mana bloodlust, arcane_charge(4), clearcasting
0:42.199 aoe t arcane_barrage Fluffy_Pillow 41986.9/69166: 61% mana arcane_charge(4)
0:43.484 aoe s arcane_explosion Fluffy_Pillow 46531.1/69166: 67% mana
0:44.772 aoe r arcane_missiles Fluffy_Pillow 43312.8/69166: 63% mana arcane_charge, clearcasting
0:46.767 aoe s arcane_explosion Fluffy_Pillow 46072.6/69166: 67% mana arcane_charge
0:48.054 aoe s arcane_explosion Fluffy_Pillow 42852.9/69166: 62% mana arcane_charge(2)
0:49.342 aoe s arcane_explosion Fluffy_Pillow 39634.6/69166: 57% mana arcane_charge(3)
0:50.628 aoe t arcane_barrage Fluffy_Pillow 36413.5/69166: 53% mana arcane_charge(4)
0:51.915 aoe q arcane_orb Fluffy_Pillow 40960.5/69166: 59% mana
0:53.201 aoe t arcane_barrage Fluffy_Pillow 42239.4/69166: 61% mana arcane_charge(4)
0:54.486 aoe s arcane_explosion Fluffy_Pillow 46783.6/69166: 68% mana
0:55.771 aoe s arcane_explosion Fluffy_Pillow 43561.2/69166: 63% mana arcane_charge
0:57.058 aoe s arcane_explosion Fluffy_Pillow 40341.5/69166: 58% mana arcane_charge(2)
0:58.345 aoe s arcane_explosion Fluffy_Pillow 37121.8/69166: 54% mana arcane_charge(3)
0:59.632 aoe t arcane_barrage Fluffy_Pillow 33902.2/69166: 49% mana arcane_charge(4)
1:00.919 aoe n touch_of_the_magi Fluffy_Pillow 38449.1/69166: 56% mana crimson_chorus
1:02.206 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 37729.4/69166: 55% mana arcane_charge(4), crimson_chorus
1:02.206 aoe p rune_of_power Fluffy_Pillow 37729.4/69166: 55% mana arcane_charge(4), crimson_chorus, gladiators_badge
1:03.493 aoe t arcane_barrage Fluffy_Pillow 39509.8/69166: 57% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:04.779 aoe s arcane_explosion Fluffy_Pillow 44055.3/69166: 64% mana rune_of_power, crimson_chorus, gladiators_badge
1:06.065 aoe s arcane_explosion Fluffy_Pillow 40834.3/69166: 59% mana arcane_charge, rune_of_power, crimson_chorus, gladiators_badge
1:07.350 aoe s arcane_explosion Fluffy_Pillow 37611.8/69166: 54% mana arcane_charge(2), rune_of_power, crimson_chorus, gladiators_badge
1:08.637 aoe s arcane_explosion Fluffy_Pillow 34392.2/69166: 50% mana arcane_charge(3), rune_of_power, crimson_chorus, gladiators_badge
1:09.923 aoe t arcane_barrage Fluffy_Pillow 31171.1/69166: 45% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:11.210 aoe s arcane_explosion Fluffy_Pillow 35718.0/69166: 52% mana rune_of_power, crimson_chorus(2), gladiators_badge
1:12.500 aoe s arcane_explosion Fluffy_Pillow 32502.5/69166: 47% mana arcane_charge, rune_of_power, crimson_chorus(2), gladiators_badge
1:13.786 aoe s arcane_explosion Fluffy_Pillow 29281.5/69166: 42% mana arcane_charge(2), rune_of_power, crimson_chorus(2), gladiators_badge
1:15.071 aoe r arcane_missiles Fluffy_Pillow 26059.0/69166: 38% mana arcane_charge(3), clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
1:17.010 aoe s arcane_explosion Fluffy_Pillow 28741.3/69166: 42% mana arcane_charge(3), crimson_chorus(2), gladiators_badge
1:18.298 aoe r arcane_missiles Fluffy_Pillow 25523.0/69166: 37% mana arcane_charge(4), clearcasting, crimson_chorus(2)
1:20.195 aoe t arcane_barrage Fluffy_Pillow 28147.1/69166: 41% mana arcane_charge(4), crimson_chorus(3)
1:21.483 aoe q arcane_orb Fluffy_Pillow 32695.5/69166: 47% mana crimson_chorus(3)
1:22.768 aoe t arcane_barrage Fluffy_Pillow 33973.0/69166: 49% mana arcane_charge(4), crimson_chorus(3)
1:24.053 aoe s arcane_explosion Fluffy_Pillow 38517.2/69166: 56% mana crimson_chorus(3)
1:25.339 aoe r arcane_missiles Fluffy_Pillow 35296.2/69166: 51% mana arcane_charge, clearcasting, crimson_chorus(3)
1:27.306 aoe s arcane_explosion Fluffy_Pillow 38017.1/69166: 55% mana arcane_charge, crimson_chorus(3)
1:28.593 aoe s arcane_explosion Fluffy_Pillow 34797.5/69166: 50% mana arcane_charge(2), crimson_chorus(3)
1:29.879 aoe s arcane_explosion Fluffy_Pillow 31576.4/69166: 46% mana arcane_charge(3), crimson_chorus(3)
1:31.166 aoe t arcane_barrage Fluffy_Pillow 28356.7/69166: 41% mana arcane_charge(4)
1:32.452 aoe s arcane_explosion Fluffy_Pillow 32902.3/69166: 48% mana
1:33.738 aoe s arcane_explosion Fluffy_Pillow 29681.2/69166: 43% mana arcane_charge
1:35.028 aoe s arcane_explosion Fluffy_Pillow 26465.7/69166: 38% mana arcane_charge(2)
1:36.314 aoe s arcane_explosion Fluffy_Pillow 23244.7/69166: 34% mana arcane_charge(3)
1:37.600 aoe t arcane_barrage Fluffy_Pillow 20023.6/69166: 29% mana arcane_charge(4)
1:38.886 aoe s arcane_explosion Fluffy_Pillow 24569.2/69166: 36% mana
1:40.171 aoe s arcane_explosion Fluffy_Pillow 21346.7/69166: 31% mana arcane_charge
1:41.457 aoe s arcane_explosion Fluffy_Pillow 18125.7/69166: 26% mana arcane_charge(2)
1:42.744 aoe s arcane_explosion Fluffy_Pillow 14906.0/69166: 22% mana arcane_charge(3)
1:44.029 aoe t arcane_barrage Fluffy_Pillow 11683.6/69166: 17% mana arcane_charge(4)
1:45.318 aoe q arcane_orb Fluffy_Pillow 16233.3/69166: 23% mana
1:46.605 aoe t arcane_barrage Fluffy_Pillow 17513.6/69166: 25% mana arcane_charge(4)
1:47.889 aoe n touch_of_the_magi Fluffy_Pillow 22056.4/69166: 32% mana
1:49.175 aoe p rune_of_power Fluffy_Pillow 21335.3/69166: 31% mana arcane_charge(4)
1:50.461 aoe t arcane_barrage Fluffy_Pillow 23114.3/69166: 33% mana arcane_charge(4), rune_of_power
1:51.747 aoe s arcane_explosion Fluffy_Pillow 27659.9/69166: 40% mana rune_of_power
1:53.035 aoe r arcane_missiles Fluffy_Pillow 24441.6/69166: 35% mana arcane_charge, clearcasting, rune_of_power
1:55.018 aoe s arcane_explosion Fluffy_Pillow 27184.7/69166: 39% mana arcane_charge, rune_of_power
1:56.302 aoe s arcane_explosion Fluffy_Pillow 23960.9/69166: 35% mana arcane_charge(2), rune_of_power
1:57.589 aoe s arcane_explosion Fluffy_Pillow 20741.2/69166: 30% mana arcane_charge(3), rune_of_power
1:58.875 aoe t arcane_barrage Fluffy_Pillow 17520.1/69166: 25% mana arcane_charge(4), rune_of_power
2:00.161 aoe s arcane_explosion Fluffy_Pillow 22065.7/69166: 32% mana rune_of_power
2:01.448 aoe s arcane_explosion Fluffy_Pillow 18846.0/69166: 27% mana arcane_charge, rune_of_power, crimson_chorus
2:02.736 aoe r arcane_missiles Fluffy_Pillow 15627.7/69166: 23% mana arcane_charge(2), clearcasting, crimson_chorus
2:04.826 aoe s arcane_explosion Fluffy_Pillow 18518.9/69166: 27% mana arcane_charge(2), crimson_chorus
2:06.112 aoe s arcane_explosion Fluffy_Pillow 15297.8/69166: 22% mana arcane_charge(3), crimson_chorus
2:07.399 aoe o arcane_power Fluffy_Pillow 12078.1/69166: 17% mana arcane_charge(4), crimson_chorus
2:07.399 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 12078.1/69166: 17% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus
2:07.399 aoe t arcane_barrage Fluffy_Pillow 12078.1/69166: 17% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:08.686 aoe q arcane_orb Fluffy_Pillow 16625.1/69166: 24% mana arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:09.972 aoe t arcane_barrage Fluffy_Pillow 18154.0/69166: 26% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, gladiators_badge
2:11.260 aoe s arcane_explosion Fluffy_Pillow 22702.4/69166: 33% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:12.548 aoe s arcane_explosion Fluffy_Pillow 21984.1/69166: 32% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.834 aoe s arcane_explosion Fluffy_Pillow 21263.0/69166: 31% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:15.121 aoe s arcane_explosion Fluffy_Pillow 20543.3/69166: 30% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.404 aoe t arcane_barrage Fluffy_Pillow 19818.1/69166: 29% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.691 aoe s arcane_explosion Fluffy_Pillow 24365.1/69166: 35% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:18.978 aoe s arcane_explosion Fluffy_Pillow 23645.4/69166: 34% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.263 aoe s arcane_explosion Fluffy_Pillow 22923.0/69166: 33% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
2:21.552 aoe s arcane_explosion Fluffy_Pillow 22206.1/69166: 32% mana arcane_charge(3), arcane_power, crimson_chorus(3), gladiators_badge
2:22.838 shared_cds v use_mana_gem pandaren 21485.0/69166: 31% mana arcane_charge(4), crimson_chorus(3)
2:22.838 aoe t arcane_barrage Fluffy_Pillow 28401.6/69166: 41% mana arcane_charge(4), crimson_chorus(3)
2:24.123 aoe s arcane_explosion Fluffy_Pillow 32945.8/69166: 48% mana crimson_chorus(3)
2:25.410 aoe s arcane_explosion Fluffy_Pillow 29726.1/69166: 43% mana arcane_charge, crimson_chorus(3)
2:26.695 aoe s arcane_explosion Fluffy_Pillow 26503.6/69166: 38% mana arcane_charge(2), crimson_chorus(3)
2:27.983 aoe r arcane_missiles Fluffy_Pillow 23285.4/69166: 34% mana arcane_charge(3), clearcasting, crimson_chorus(3)
2:29.910 aoe s arcane_explosion Fluffy_Pillow 25951.0/69166: 38% mana arcane_charge(3), crimson_chorus(3)
2:31.196 aoe t arcane_barrage Fluffy_Pillow 22729.9/69166: 33% mana arcane_charge(4)
2:32.483 aoe q arcane_orb Fluffy_Pillow 27276.9/69166: 39% mana
2:33.769 aoe t arcane_barrage Fluffy_Pillow 28555.8/69166: 41% mana arcane_charge(4)
2:35.055 aoe n touch_of_the_magi Fluffy_Pillow 33101.4/69166: 48% mana
2:36.340 aoe p rune_of_power Fluffy_Pillow 32379.0/69166: 47% mana arcane_charge(4)
2:37.627 aoe t arcane_barrage Fluffy_Pillow 34159.3/69166: 49% mana arcane_charge(4), rune_of_power
2:38.914 aoe s arcane_explosion Fluffy_Pillow 38706.2/69166: 56% mana rune_of_power
2:40.200 aoe r arcane_missiles Fluffy_Pillow 35485.2/69166: 51% mana arcane_charge, clearcasting, rune_of_power
2:42.206 aoe s arcane_explosion Fluffy_Pillow 38260.1/69166: 55% mana arcane_charge, rune_of_power
2:43.492 aoe s arcane_explosion Fluffy_Pillow 35039.1/69166: 51% mana arcane_charge(2), rune_of_power
2:44.778 aoe s arcane_explosion Fluffy_Pillow 31818.0/69166: 46% mana arcane_charge(3), rune_of_power
2:46.064 aoe t arcane_barrage Fluffy_Pillow 28596.9/69166: 41% mana arcane_charge(4), rune_of_power
2:47.351 aoe s arcane_explosion Fluffy_Pillow 33143.9/69166: 48% mana rune_of_power
2:48.639 aoe r arcane_missiles Fluffy_Pillow 29925.6/69166: 43% mana arcane_charge, clearcasting, rune_of_power
2:50.570 aoe s arcane_explosion Fluffy_Pillow 32596.8/69166: 47% mana arcane_charge
2:51.855 aoe s arcane_explosion Fluffy_Pillow 29374.3/69166: 42% mana arcane_charge(2)
2:53.142 aoe r arcane_missiles Fluffy_Pillow 26154.7/69166: 38% mana arcane_charge(3), clearcasting
2:54.934 aoe s arcane_explosion Fluffy_Pillow 28633.6/69166: 41% mana arcane_charge(3)
2:56.221 aoe t arcane_barrage Fluffy_Pillow 25413.9/69166: 37% mana arcane_charge(4)
2:57.508 aoe q arcane_orb Fluffy_Pillow 29960.8/69166: 43% mana
2:58.796 aoe t arcane_barrage Fluffy_Pillow 31242.6/69166: 45% mana arcane_charge(4)
3:00.082 aoe s arcane_explosion Fluffy_Pillow 35788.1/69166: 52% mana
3:01.369 aoe s arcane_explosion Fluffy_Pillow 32568.5/69166: 47% mana arcane_charge
3:02.656 aoe s arcane_explosion Fluffy_Pillow 29348.8/69166: 42% mana arcane_charge(2), crimson_chorus
3:03.942 aoe s arcane_explosion Fluffy_Pillow 26127.7/69166: 38% mana arcane_charge(3), crimson_chorus
3:05.229 aoe r arcane_missiles Fluffy_Pillow 22908.0/69166: 33% mana arcane_charge(4), clearcasting, crimson_chorus
3:07.203 aoe t arcane_barrage Fluffy_Pillow 25638.7/69166: 37% mana arcane_charge(4), crimson_chorus
3:08.489 aoe s arcane_explosion Fluffy_Pillow 30184.3/69166: 44% mana crimson_chorus
3:09.774 aoe s arcane_explosion Fluffy_Pillow 26961.8/69166: 39% mana arcane_charge, crimson_chorus
3:11.060 aoe s arcane_explosion Fluffy_Pillow 23740.8/69166: 34% mana arcane_charge(2), crimson_chorus
3:12.347 aoe s arcane_explosion Fluffy_Pillow 20521.1/69166: 30% mana arcane_charge(3), crimson_chorus(2)
3:13.633 aoe t arcane_barrage Fluffy_Pillow 17300.0/69166: 25% mana arcane_charge(4), crimson_chorus(2)
3:14.921 aoe s arcane_explosion Fluffy_Pillow 21848.4/69166: 32% mana crimson_chorus(2)
3:16.207 aoe r arcane_missiles Fluffy_Pillow 18627.3/69166: 27% mana arcane_charge, clearcasting, crimson_chorus(2)
3:18.189 aoe s arcane_explosion Fluffy_Pillow 21369.1/69166: 31% mana arcane_charge, crimson_chorus(2)
3:19.474 aoe s arcane_explosion Fluffy_Pillow 18146.6/69166: 26% mana arcane_charge(2), crimson_chorus(2)
3:20.759 aoe s arcane_explosion Fluffy_Pillow 14924.2/69166: 22% mana arcane_charge(3), crimson_chorus(2)
3:22.046 aoe t arcane_barrage Fluffy_Pillow 11704.5/69166: 17% mana arcane_charge(4), crimson_chorus(3)
3:23.332 aoe n touch_of_the_magi Fluffy_Pillow 16250.1/69166: 23% mana crimson_chorus(3)
3:24.619 aoe p rune_of_power Fluffy_Pillow 15530.4/69166: 22% mana arcane_charge(4), crimson_chorus(3)
3:25.907 aoe t arcane_barrage Fluffy_Pillow 17312.1/69166: 25% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:27.194 aoe q arcane_orb Fluffy_Pillow 21859.1/69166: 32% mana rune_of_power, crimson_chorus(3)
3:28.480 aoe t arcane_barrage Fluffy_Pillow 23138.0/69166: 33% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:29.766 aoe s arcane_explosion Fluffy_Pillow 27683.6/69166: 40% mana rune_of_power, crimson_chorus(3)
3:31.052 aoe r arcane_missiles Fluffy_Pillow 24462.5/69166: 35% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(3)
3:32.994 aoe s arcane_explosion Fluffy_Pillow 27148.9/69166: 39% mana arcane_charge, rune_of_power
3:34.279 aoe s arcane_explosion Fluffy_Pillow 23926.5/69166: 35% mana arcane_charge(2), rune_of_power
3:35.566 aoe s arcane_explosion Fluffy_Pillow 20706.8/69166: 30% mana arcane_charge(3), rune_of_power
3:36.852 aoe t arcane_barrage Fluffy_Pillow 17485.7/69166: 25% mana arcane_charge(4), rune_of_power
3:38.139 aoe s arcane_explosion Fluffy_Pillow 22032.7/69166: 32% mana
3:39.425 aoe s arcane_explosion Fluffy_Pillow 18811.6/69166: 27% mana arcane_charge
3:40.710 aoe r arcane_missiles Fluffy_Pillow 15589.2/69166: 23% mana arcane_charge(2), clearcasting
3:42.552 aoe s arcane_explosion Fluffy_Pillow 18137.3/69166: 26% mana arcane_charge(2)
3:43.838 aoe s arcane_explosion Fluffy_Pillow 14916.2/69166: 22% mana arcane_charge(3)
3:45.125 aoe r arcane_missiles Fluffy_Pillow 11696.5/69166: 17% mana arcane_charge(4), clearcasting
3:47.020 aoe t arcane_barrage Fluffy_Pillow 14317.9/69166: 21% mana arcane_charge(4)
3:48.304 aoe q arcane_orb Fluffy_Pillow 18860.7/69166: 27% mana
3:49.591 aoe t arcane_barrage Fluffy_Pillow 20141.0/69166: 29% mana arcane_charge(4)
3:50.878 aoe s arcane_explosion Fluffy_Pillow 24688.0/69166: 36% mana
3:52.164 aoe r arcane_missiles Fluffy_Pillow 21466.9/69166: 31% mana arcane_charge, clearcasting
3:54.085 aoe s arcane_explosion Fluffy_Pillow 24124.3/69166: 35% mana arcane_charge
3:55.372 aoe s arcane_explosion Fluffy_Pillow 20904.6/69166: 30% mana arcane_charge(2)
3:56.658 aoe s arcane_explosion Fluffy_Pillow 17683.5/69166: 26% mana arcane_charge(3)
3:57.943 aoe t arcane_barrage Fluffy_Pillow 14461.1/69166: 21% mana arcane_charge(4)
3:59.230 aoe s arcane_explosion Fluffy_Pillow 19008.1/69166: 27% mana
4:00.515 aoe s arcane_explosion Fluffy_Pillow 15785.6/69166: 23% mana arcane_charge
4:01.802 aoe s arcane_explosion Fluffy_Pillow 12565.9/69166: 18% mana arcane_charge(2)
4:03.088 aoe s arcane_explosion Fluffy_Pillow 9344.9/69166: 14% mana arcane_charge(3), crimson_chorus
4:04.376 aoe r arcane_missiles Fluffy_Pillow 6126.6/69166: 9% mana arcane_charge(4), clearcasting, crimson_chorus
4:06.366 aoe t arcane_barrage Fluffy_Pillow 8879.4/69166: 13% mana arcane_charge(4), crimson_chorus
4:07.653 aoe s arcane_explosion Fluffy_Pillow 13426.3/69166: 19% mana crimson_chorus
4:08.938 aoe s arcane_explosion Fluffy_Pillow 10203.9/69166: 15% mana arcane_charge, crimson_chorus
4:10.224 aoe n touch_of_the_magi Fluffy_Pillow 6982.8/69166: 10% mana arcane_charge(2), crimson_chorus
4:11.511 aoe o arcane_power Fluffy_Pillow 6263.2/69166: 9% mana arcane_charge(4), clearcasting, crimson_chorus
4:11.511 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 6263.2/69166: 9% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus
4:11.511 aoe t arcane_barrage Fluffy_Pillow 6263.2/69166: 9% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus, gladiators_badge
4:12.797 aoe q arcane_orb Fluffy_Pillow 10808.7/69166: 16% mana arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:14.085 aoe r arcane_missiles Fluffy_Pillow 12340.4/69166: 18% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:16.026 aoe t arcane_barrage Fluffy_Pillow 15025.5/69166: 22% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:17.312 aoe s arcane_explosion Fluffy_Pillow 19571.0/69166: 28% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.598 aoe s arcane_explosion Fluffy_Pillow 18850.0/69166: 27% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:19.884 aoe s arcane_explosion Fluffy_Pillow 18128.9/69166: 26% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.170 aoe s arcane_explosion Fluffy_Pillow 17407.9/69166: 25% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:22.457 aoe t arcane_barrage Fluffy_Pillow 16688.2/69166: 24% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:23.742 shared_cds v use_mana_gem pandaren 21232.4/69166: 31% mana arcane_power, crimson_chorus(3), gladiators_badge
4:23.742 aoe s arcane_explosion Fluffy_Pillow 28148.9/69166: 41% mana arcane_power, crimson_chorus(3), gladiators_badge
4:25.029 aoe s arcane_explosion Fluffy_Pillow 27429.3/69166: 40% mana arcane_charge, arcane_power, crimson_chorus(3), gladiators_badge
4:26.315 aoe s arcane_explosion Fluffy_Pillow 26708.2/69166: 39% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
4:27.600 aoe s arcane_explosion Fluffy_Pillow 25985.8/69166: 38% mana arcane_charge(3), crimson_chorus(3)
4:28.887 aoe p rune_of_power Fluffy_Pillow 22766.1/69166: 33% mana arcane_charge(4), crimson_chorus(3)
4:30.173 aoe t arcane_barrage Fluffy_Pillow 24545.0/69166: 35% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
4:31.461 aoe s arcane_explosion Fluffy_Pillow 29093.4/69166: 42% mana rune_of_power, crimson_chorus(3)
4:32.747 aoe r arcane_missiles Fluffy_Pillow 25872.3/69166: 37% mana arcane_charge, clearcasting, rune_of_power
4:34.773 aoe s arcane_explosion Fluffy_Pillow 28674.9/69166: 41% mana arcane_charge, rune_of_power
4:36.061 aoe s arcane_explosion Fluffy_Pillow 25456.6/69166: 37% mana arcane_charge(2), rune_of_power
4:37.347 aoe s arcane_explosion Fluffy_Pillow 22235.6/69166: 32% mana arcane_charge(3), rune_of_power
4:38.634 aoe r arcane_missiles Fluffy_Pillow 19015.9/69166: 27% mana arcane_charge(4), clearcasting, rune_of_power
4:40.697 aoe t arcane_barrage Fluffy_Pillow 21869.7/69166: 32% mana arcane_charge(4), rune_of_power
4:41.984 aoe q arcane_orb Fluffy_Pillow 26416.6/69166: 38% mana rune_of_power
4:43.269 aoe t arcane_barrage Fluffy_Pillow 27694.2/69166: 40% mana arcane_charge(4)
4:44.555 aoe s arcane_explosion Fluffy_Pillow 32239.7/69166: 47% mana
4:45.842 aoe r arcane_missiles Fluffy_Pillow 29020.1/69166: 42% mana arcane_charge, clearcasting
4:47.866 aoe s arcane_explosion Fluffy_Pillow 31819.9/69166: 46% mana arcane_charge
4:49.153 aoe r arcane_missiles Fluffy_Pillow 28600.2/69166: 41% mana arcane_charge(2), clearcasting
4:51.186 aoe s arcane_explosion Fluffy_Pillow 31412.5/69166: 45% mana arcane_charge(2)
4:52.473 aoe s arcane_explosion Fluffy_Pillow 28192.8/69166: 41% mana arcane_charge(3)
4:53.759 aoe t arcane_barrage Fluffy_Pillow 24971.8/69166: 36% mana arcane_charge(4)
4:55.044 aoe s arcane_explosion Fluffy_Pillow 29516.0/69166: 43% mana
4:56.331 aoe r arcane_missiles Fluffy_Pillow 26296.3/69166: 38% mana arcane_charge, clearcasting
4:58.303 aoe s arcane_explosion Fluffy_Pillow 29024.2/69166: 42% mana arcane_charge
4:59.589 aoe s arcane_explosion Fluffy_Pillow 25803.1/69166: 37% mana arcane_charge(2)
5:00.876 aoe s arcane_explosion Fluffy_Pillow 22583.5/69166: 33% mana arcane_charge(3)
5:02.162 aoe t arcane_barrage Fluffy_Pillow 19362.4/69166: 28% mana arcane_charge(4)

Stats

Level Bonus (60) Race Bonus (pandaren) Raid-Buffed Unbuffed Gear Amount
Strength 198 0 198 198 0
Agility 306 -2 304 304 0
Stamina 414 2 2029 1933 1517
Intellect 450 0 1818 1615 1089 (46)
Spirit 0 0 0 0 0
Health 40580 38660 0
Mana 69166 69166 0
Spell Power 1818 1615 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="pandaren"
source=default
spec=arcane
level=60
race=pandaren
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

void_elf : 8925 dps, 4567 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8924.8 8924.8 16.1 / 0.180% 1051.8 / 11.8% 4.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
2042.3 1938.9 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
void_elf 8925
Arcane Barrage 3709 41.6% 50.0 6.03sec 22319 18044 Direct 149.8 6312 12874 7452 17.4%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.01 149.82 0.00 0.00 1.2369 0.0000 1116182.10 1116182.10 0.00% 18044.26 18044.26
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.63% 123.79 89 161 6311.69 2176 30759 6303.17 5429 7180 781025 781025 0.00%
crit 17.37% 26.03 7 45 12874.03 4351 61517 12850.13 7651 20026 335157 335157 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.01
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 3 0.0% 0.0 0.00sec 0 0 Direct 1.0 912 1823 1031 13.1%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1031.37 1031.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 86.85% 0.87 0 1 911.52 912 912 791.67 0 912 792 792 0.00%
crit 13.15% 0.13 0 1 1823.03 1823 1823 239.70 0 1823 240 240 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2901 32.5% 129.4 2.29sec 6738 5463 Direct 388.2 1903 3899 2246 17.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.42 388.25 0.00 0.00 1.2333 0.0000 871982.33 871982.33 0.00% 5463.10 5463.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.79% 321.42 243 409 1902.64 1454 3575 1902.83 1764 2026 611429 611429 0.00%
crit 17.21% 66.82 34 100 3898.97 2908 7151 3898.93 3367 4481 260553 260553 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.42
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 1006 11.3% 24.4 11.89sec 12375 6514 Periodic 194.9 1319 2686 1552 17.1% 4.5%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.45 0.00 195.04 194.91 1.8999 0.2065 302536.01 302536.01 0.00% 6513.57 6513.57
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 82.95% 161.67 87 259 1319.03 1066 2621 1318.47 1094 1589 213257 213257 0.00%
crit 17.05% 33.24 11 68 2685.69 2132 5241 2684.01 2174 3498 89279 89279 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.44
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (587) 0.0% (6.6%) 12.7 24.38sec 13889 11203

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.70 0.00 0.00 0.00 1.2399 0.0000 0.00 0.00 0.00% 11202.61 11202.61

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.70
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 587 6.6% 38.0 24.38sec 4637 0 Direct 38.0 3944 8031 4639 17.0%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.03 38.03 0.00 0.00 0.0000 0.0000 176373.95 176373.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.03% 31.58 19 45 3943.54 2874 7066 3942.49 3228 4525 124519 124519 0.00%
crit 16.97% 6.46 1 16 8031.38 5748 14132 8024.98 5748 13332 51855 51855 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 13.9 1.76sec 513 0 Periodic 40.9 (42.8) 112 0 112 0.0% (0.0%) 4.5%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.90 0.00 40.89 40.89 0.0000 0.9860 4590.91 4590.91 0.00% 176.84 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.89 12 62 112.31 0 202 112.19 66 168 4591 4591 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 9.46sec 1337 0 Direct 1.9 1115 2234 1339 19.9%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.90 1.90 0.00 0.00 0.0000 0.0000 2539.15 2539.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.12% 1.52 0 3 1114.73 1093 1158 1033.01 0 1158 1696 1696 0.00%
crit 19.88% 0.38 0 3 2234.05 2185 2316 755.42 0 2316 843 843 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Entropic Embrace 121 1.3% 166.5 3.45sec 218 0 Direct 166.5 218 0 218 0.0%

Stats Details: Entropic Embrace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 166.51 166.51 0.00 0.00 0.0000 0.0000 36227.56 36227.56 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 166.51 111 215 217.65 23 3424 217.85 141 300 36228 36228 0.00%

Action Details: Entropic Embrace

  • id:259756
  • school:shadowfrost
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:224.87
  • base_dd_max:224.87
  • base_dd_mult:1.00

Spelldata

  • id:259756
  • name:Entropic Embrace
  • school:shadowfrost
  • tooltip:
  • description:{$@spelldesc256374={$@spelldesc255669=Your abilities have a chance to empower you with the essence of the Void, causing your damage and healing effects to deal an additional {$256374s1=5}% as Shadowfrost for {$256374d=12 seconds}.}}
Eternal Insight 36 0.4% 20.2 14.43sec 531 0 Direct 20.2 452 904 531 17.3%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.24 20.24 0.00 0.00 0.0000 0.0000 10737.78 10737.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.66% 16.73 8 30 452.20 444 470 452.22 444 462 7564 7564 0.00%
crit 17.34% 3.51 0 11 904.23 887 941 881.43 0 941 3174 3174 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4094 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 102  / 14 0.2% 90.0 1.31sec 45 34 Direct 90.0 38 77 45 18.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4094.00 4094.00 0.00% 34.28 34.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.65% 73.49 61 83 38.31 30 46 38.31 37 39 2815 2815 0.00%
crit 18.35% 16.51 7 29 77.47 59 92 77.45 69 86 1279 1279 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (524) 0.0% (5.9%) 6.2 51.92sec 25366 19717

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19717.30 19717.30

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 524 5.9% 6.2 51.80sec 25366 0 Direct 18.6 8491 0 8491 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.55 0.00 0.00 0.0000 0.0000 157482.07 157482.07 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.55 12 21 8491.25 714 41172 8477.00 5541 12404 157482 157482 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5398.44
  • base_dd_max:5398.44
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
void_elf
Arcane Power 2.9 127.14sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.88
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.50 0.00 2.99 0.00 4.2275 0.7103 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:void_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.50
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:void_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:void_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.18sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 1.2377 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.08
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.64sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:void_elf
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.8 136.6 6.0sec 1.6sec 4.6sec 78.03% 0.00% 2.9 (4.0) 0.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 17.9s
  • trigger_min/max:0.0s / 8.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.4s

Stack Uptimes

  • arcane_charge_1:20.58%
  • arcane_charge_2:17.65%
  • arcane_charge_3:16.91%
  • arcane_charge_4:22.89%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.1sec 127.1sec 14.7sec 14.04% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 138.9s
  • trigger_min/max:120.0s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:14.04%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.6 0.0 11.8sec 11.8sec 1.3sec 10.51% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.50%
  • clearcasting_2:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.6sec 52.05% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 65.5s
  • trigger_min/max:60.0s / 65.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.94%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.77%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Entropic Embrace 5.3 0.0 62.2sec 62.2sec 11.8sec 20.87% 0.00% 0.0 (0.0) 5.1

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_entropic_embrace
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:60.0s / 82.8s
  • trigger_min/max:60.0s / 82.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • entropic_embrace_1:20.87%

Spelldata

  • id:256374
  • name:Entropic Embrace
  • tooltip:Your damage and healing effects deal an additional $w1% as Shadowfrost.
  • description:{$@spelldesc255669=Your abilities have a chance to empower you with the essence of the Void, causing your damage and healing effects to deal an additional {$256374s1=5}% as Shadowfrost for {$256374d=12 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.5 0.0 226.6sec 226.6sec 4.2sec 0.71% 0.00% 2.0 (2.0) 0.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:200.1s / 253.1s
  • trigger_min/max:200.1s / 253.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:0.71%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 4.0 0.0 86.3sec 86.3sec 14.6sec 19.13% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 138.9s
  • trigger_min/max:60.0s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.13%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.9sec 34.9sec 11.8sec 35.02% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 60.5s
  • trigger_min/max:12.1s / 60.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.02%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.94% 0.78% 5.30% 0.9s 0.0s 4.1s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation222.20389.073357.656268.537151.155359.948
Rune of Power6.0940.00430.64438.27917.00983.307
Touch of the Magi4.7760.00025.38731.40315.42681.723
Arcane Power5.1060.00018.88514.8932.24529.875
Arcane Barrage3.5230.00414.090177.948138.415217.132
Arcane Orb4.2630.00018.61854.81731.88290.146

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
void_elf
mana_regen Mana 1095.69 405998.47 69.62% 370.54 9498.02 2.29%
Evocation Mana 23.51 26409.85 4.53% 1123.28 0.00 0.00%
Mana Gem Mana 2.74 18950.43 3.25% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.01 131845.18 22.61% 2636.58 6503.32 4.70%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1938.92 2042.33 15948.9 38060.5 330.4 69165.7
Usage Type Count Total Avg RPE APR
void_elf
arcane_explosion Mana 129.4 591589.5 4571.2 4571.2 1.5
arcane_orb Mana 12.7 5789.0 455.9 455.9 30.5
touch_of_the_magi Mana 6.2 15504.9 2498.9 2497.4 10.2

Statistics & Data Analysis

Fight Length
void_elf Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
void_elf Damage Per Second
Count 1118
Mean 8924.82
Minimum 8114.04
Maximum 9829.98
Spread ( max - min ) 1715.94
Range [ ( max - min ) / 2 * 100% ] 9.61%
Standard Deviation 274.1541
5th Percentile 8495.10
95th Percentile 9387.20
( 95th Percentile - 5th Percentile ) 892.10
Mean Distribution
Standard Deviation 8.1992
95.00% Confidence Interval ( 8908.75 - 8940.89 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3625
0.1 Scale Factor Error with Delta=300 642
0.05 Scale Factor Error with Delta=300 2567
0.01 Scale Factor Error with Delta=300 64162
Priority Target DPS
void_elf Priority Target Damage Per Second
Count 1118
Mean 4566.70
Minimum 3947.50
Maximum 5303.95
Spread ( max - min ) 1356.45
Range [ ( max - min ) / 2 * 100% ] 14.85%
Standard Deviation 201.2994
5th Percentile 4253.50
95th Percentile 4917.46
( 95th Percentile - 5th Percentile ) 663.96
Mean Distribution
Standard Deviation 6.0203
95.00% Confidence Interval ( 4554.90 - 4578.50 )
Normalized 95.00% Confidence Interval ( 99.74% - 100.26% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 75
0.1% Error 7465
0.1 Scale Factor Error with Delta=300 346
0.05 Scale Factor Error with Delta=300 1384
0.01 Scale Factor Error with Delta=300 34592
DPS(e)
void_elf Damage Per Second (Effective)
Count 1118
Mean 8924.82
Minimum 8114.04
Maximum 9829.98
Spread ( max - min ) 1715.94
Range [ ( max - min ) / 2 * 100% ] 9.61%
Damage
void_elf Damage
Count 1118
Mean 2679683.24
Minimum 1975307.86
Maximum 3275767.50
Spread ( max - min ) 1300459.64
Range [ ( max - min ) / 2 * 100% ] 24.27%
DTPS
void_elf Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
void_elf Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
void_elf Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
void_elf Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
void_elf Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
void_elf Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
void_elfTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
void_elf Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.88 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.08 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.70 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.44 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.42 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.01 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.50 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.95 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxtqtsssstsssstssssptsssvsrtqtssrssrtsrssrstsssrsrtqtssrnxptsssstssrssrtqtsrssstssrsstsssrstnptqtsssrstsssrsoxtsrssstvqtsssstsssstnptsrssstqtsssrsrtsssrstqtssrsstssnptsssstqtsssrstsssstsssrstqtsrssstnoxtsrssstvqtssssptssssrtssrsrstqtssssts

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask void_elf 69165.7/69166: 100% mana
Pre precombat U food void_elf 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana
0:01.287 aoe o arcane_power Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, crimson_chorus
0:01.287 shared_cds w potion Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:01.287 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.287 aoe t arcane_barrage Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.277 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.269 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:04.260 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:05.249 aoe s arcane_explosion Fluffy_Pillow 68033.8/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:06.238 aoe s arcane_explosion Fluffy_Pillow 66901.9/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:07.230 aoe s arcane_explosion Fluffy_Pillow 65774.2/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:08.221 aoe t arcane_barrage Fluffy_Pillow 64645.0/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:09.211 aoe s arcane_explosion Fluffy_Pillow 68781.1/69166: 99% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:10.201 aoe s arcane_explosion Fluffy_Pillow 67650.6/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:11.192 aoe s arcane_explosion Fluffy_Pillow 66521.5/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:12.184 aoe s arcane_explosion Fluffy_Pillow 65393.7/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:13.174 aoe t arcane_barrage Fluffy_Pillow 64263.2/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:14.166 aoe s arcane_explosion Fluffy_Pillow 68402.1/69166: 99% mana bloodlust, arcane_power, crimson_chorus(2), entropic_embrace, potion_of_deathly_fixation, gladiators_badge
0:15.156 aoe s arcane_explosion Fluffy_Pillow 67271.6/69166: 97% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.147 aoe s arcane_explosion Fluffy_Pillow 66142.4/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.138 aoe s arcane_explosion Fluffy_Pillow 65013.3/69166: 94% mana bloodlust, arcane_charge(3), crimson_chorus(2), potion_of_deathly_fixation
0:18.128 aoe p rune_of_power Fluffy_Pillow 61382.8/69166: 89% mana bloodlust, arcane_charge(4), crimson_chorus(2), potion_of_deathly_fixation
0:19.118 aoe t arcane_barrage Fluffy_Pillow 62752.3/69166: 91% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.109 aoe s arcane_explosion Fluffy_Pillow 66889.7/69166: 97% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.098 aoe s arcane_explosion Fluffy_Pillow 63257.8/69166: 91% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.087 aoe s arcane_explosion Fluffy_Pillow 59625.9/69166: 86% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.079 shared_cds v use_mana_gem void_elf 55998.2/69166: 81% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.079 aoe s arcane_explosion Fluffy_Pillow 62914.8/69166: 91% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.071 aoe r arcane_missiles Fluffy_Pillow 59287.0/69166: 86% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.573 aoe t arcane_barrage Fluffy_Pillow 61364.7/69166: 89% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.564 aoe q arcane_orb Fluffy_Pillow 65502.2/69166: 95% mana bloodlust, rune_of_power, crimson_chorus(3)
0:27.554 aoe t arcane_barrage Fluffy_Pillow 66371.7/69166: 96% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3)
0:28.545 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3)
0:29.535 aoe s arcane_explosion Fluffy_Pillow 65535.2/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3)
0:30.526 aoe r arcane_missiles Fluffy_Pillow 61906.1/69166: 90% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:32.140 aoe s arcane_explosion Fluffy_Pillow 64138.7/69166: 93% mana bloodlust, arcane_charge(2)
0:33.130 aoe s arcane_explosion Fluffy_Pillow 60508.2/69166: 87% mana bloodlust, arcane_charge(3)
0:34.120 aoe r arcane_missiles Fluffy_Pillow 56877.7/69166: 82% mana bloodlust, arcane_charge(4), clearcasting
0:35.668 aoe t arcane_barrage Fluffy_Pillow 59019.1/69166: 85% mana bloodlust, arcane_charge(4)
0:36.657 aoe s arcane_explosion Fluffy_Pillow 63153.8/69166: 91% mana bloodlust
0:37.649 aoe r arcane_missiles Fluffy_Pillow 59526.0/69166: 86% mana bloodlust, arcane_charge, clearcasting
0:39.194 aoe s arcane_explosion Fluffy_Pillow 61663.3/69166: 89% mana bloodlust, arcane_charge
0:40.184 aoe s arcane_explosion Fluffy_Pillow 58032.7/69166: 84% mana bloodlust, arcane_charge(2)
0:41.175 aoe r arcane_missiles Fluffy_Pillow 54403.6/69166: 79% mana arcane_charge(3), clearcasting
0:43.157 aoe s arcane_explosion Fluffy_Pillow 57145.3/69166: 83% mana arcane_charge(3)
0:44.443 aoe t arcane_barrage Fluffy_Pillow 53924.3/69166: 78% mana arcane_charge(4)
0:45.730 aoe s arcane_explosion Fluffy_Pillow 58471.2/69166: 85% mana
0:47.015 aoe s arcane_explosion Fluffy_Pillow 55248.8/69166: 80% mana arcane_charge
0:48.302 aoe s arcane_explosion Fluffy_Pillow 52029.1/69166: 75% mana arcane_charge(2)
0:49.588 aoe r arcane_missiles Fluffy_Pillow 48808.1/69166: 71% mana arcane_charge(3), clearcasting
0:51.500 aoe s arcane_explosion Fluffy_Pillow 51453.0/69166: 74% mana arcane_charge(3)
0:52.786 aoe r arcane_missiles Fluffy_Pillow 48231.9/69166: 70% mana arcane_charge(4), clearcasting
0:54.657 aoe t arcane_barrage Fluffy_Pillow 50820.1/69166: 73% mana arcane_charge(4)
0:55.943 aoe q arcane_orb Fluffy_Pillow 55365.6/69166: 80% mana
0:57.229 aoe t arcane_barrage Fluffy_Pillow 56644.6/69166: 82% mana arcane_charge(4)
0:58.516 aoe s arcane_explosion Fluffy_Pillow 61191.5/69166: 88% mana
0:59.804 aoe s arcane_explosion Fluffy_Pillow 57973.2/69166: 84% mana arcane_charge
1:01.091 aoe r arcane_missiles Fluffy_Pillow 54753.6/69166: 79% mana arcane_charge(2), clearcasting
1:02.995 aoe n touch_of_the_magi Fluffy_Pillow 57387.4/69166: 83% mana arcane_charge(2), crimson_chorus
1:04.282 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 56667.7/69166: 82% mana arcane_charge(4), crimson_chorus
1:04.282 aoe p rune_of_power Fluffy_Pillow 56667.7/69166: 82% mana arcane_charge(4), crimson_chorus, gladiators_badge
1:05.568 aoe t arcane_barrage Fluffy_Pillow 58446.7/69166: 85% mana arcane_charge(4), rune_of_power, crimson_chorus, gladiators_badge
1:06.854 aoe s arcane_explosion Fluffy_Pillow 62992.2/69166: 91% mana rune_of_power, crimson_chorus, entropic_embrace, gladiators_badge
1:08.142 aoe s arcane_explosion Fluffy_Pillow 59774.0/69166: 86% mana arcane_charge, rune_of_power, crimson_chorus, entropic_embrace, gladiators_badge
1:09.428 aoe s arcane_explosion Fluffy_Pillow 56552.9/69166: 82% mana arcane_charge(2), rune_of_power, crimson_chorus, entropic_embrace, gladiators_badge
1:10.716 aoe s arcane_explosion Fluffy_Pillow 53334.6/69166: 77% mana arcane_charge(3), rune_of_power, crimson_chorus, entropic_embrace, gladiators_badge
1:12.004 aoe t arcane_barrage Fluffy_Pillow 50116.3/69166: 72% mana arcane_charge(4), rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
1:13.292 aoe s arcane_explosion Fluffy_Pillow 54664.6/69166: 79% mana rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
1:14.578 aoe s arcane_explosion Fluffy_Pillow 51443.6/69166: 74% mana arcane_charge, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
1:15.863 aoe r arcane_missiles Fluffy_Pillow 48221.2/69166: 70% mana arcane_charge(2), clearcasting, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
1:17.887 aoe s arcane_explosion Fluffy_Pillow 51021.0/69166: 74% mana arcane_charge(2), crimson_chorus(2), gladiators_badge
1:19.173 aoe s arcane_explosion Fluffy_Pillow 47799.9/69166: 69% mana arcane_charge(3), crimson_chorus(2), gladiators_badge
1:20.461 aoe r arcane_missiles Fluffy_Pillow 44581.6/69166: 64% mana arcane_charge(4), clearcasting, crimson_chorus(2)
1:22.393 aoe t arcane_barrage Fluffy_Pillow 47254.2/69166: 68% mana arcane_charge(4), crimson_chorus(3)
1:23.681 aoe q arcane_orb Fluffy_Pillow 51802.5/69166: 75% mana crimson_chorus(3)
1:24.968 aoe t arcane_barrage Fluffy_Pillow 53082.9/69166: 77% mana arcane_charge(4), crimson_chorus(3)
1:26.255 aoe s arcane_explosion Fluffy_Pillow 57629.8/69166: 83% mana crimson_chorus(3)
1:27.543 aoe r arcane_missiles Fluffy_Pillow 54411.5/69166: 79% mana arcane_charge, clearcasting, crimson_chorus(3)
1:29.475 aoe s arcane_explosion Fluffy_Pillow 57084.1/69166: 83% mana arcane_charge, crimson_chorus(3)
1:30.761 aoe s arcane_explosion Fluffy_Pillow 53863.0/69166: 78% mana arcane_charge(2), crimson_chorus(3)
1:32.050 aoe s arcane_explosion Fluffy_Pillow 50646.1/69166: 73% mana arcane_charge(3)
1:33.336 aoe t arcane_barrage Fluffy_Pillow 47425.1/69166: 69% mana arcane_charge(4)
1:34.621 aoe s arcane_explosion Fluffy_Pillow 51969.2/69166: 75% mana
1:35.908 aoe s arcane_explosion Fluffy_Pillow 48749.6/69166: 70% mana arcane_charge
1:37.193 aoe r arcane_missiles Fluffy_Pillow 45527.1/69166: 66% mana arcane_charge(2), clearcasting
1:39.138 aoe s arcane_explosion Fluffy_Pillow 48217.7/69166: 70% mana arcane_charge(2)
1:40.425 aoe s arcane_explosion Fluffy_Pillow 44998.0/69166: 65% mana arcane_charge(3)
1:41.711 aoe t arcane_barrage Fluffy_Pillow 41776.9/69166: 60% mana arcane_charge(4)
1:42.997 aoe s arcane_explosion Fluffy_Pillow 46322.5/69166: 67% mana
1:44.285 aoe s arcane_explosion Fluffy_Pillow 43104.2/69166: 62% mana arcane_charge
1:45.573 aoe s arcane_explosion Fluffy_Pillow 39885.9/69166: 58% mana arcane_charge(2)
1:46.861 aoe r arcane_missiles Fluffy_Pillow 36667.6/69166: 53% mana arcane_charge(3), clearcasting
1:48.798 aoe s arcane_explosion Fluffy_Pillow 39347.1/69166: 57% mana arcane_charge(3)
1:50.085 aoe t arcane_barrage Fluffy_Pillow 36127.4/69166: 52% mana arcane_charge(4)
1:51.370 aoe n touch_of_the_magi Fluffy_Pillow 40671.6/69166: 59% mana
1:52.655 aoe p rune_of_power Fluffy_Pillow 39949.2/69166: 58% mana arcane_charge(4)
1:53.941 aoe t arcane_barrage Fluffy_Pillow 41728.1/69166: 60% mana arcane_charge(4), rune_of_power
1:55.227 aoe q arcane_orb Fluffy_Pillow 46273.7/69166: 67% mana rune_of_power
1:56.514 aoe t arcane_barrage Fluffy_Pillow 47554.0/69166: 69% mana arcane_charge(4), rune_of_power
1:57.801 aoe s arcane_explosion Fluffy_Pillow 52101.0/69166: 75% mana rune_of_power
1:59.088 aoe s arcane_explosion Fluffy_Pillow 48881.3/69166: 71% mana arcane_charge, rune_of_power
2:00.378 aoe s arcane_explosion Fluffy_Pillow 45665.8/69166: 66% mana arcane_charge(2), rune_of_power
2:01.665 aoe r arcane_missiles Fluffy_Pillow 42446.1/69166: 61% mana arcane_charge(3), clearcasting, rune_of_power
2:03.551 aoe s arcane_explosion Fluffy_Pillow 45055.0/69166: 65% mana arcane_charge(3), rune_of_power, crimson_chorus
2:04.837 aoe t arcane_barrage Fluffy_Pillow 41834.0/69166: 60% mana arcane_charge(4), rune_of_power, crimson_chorus
2:06.126 aoe s arcane_explosion Fluffy_Pillow 46383.7/69166: 67% mana crimson_chorus
2:07.413 aoe s arcane_explosion Fluffy_Pillow 43164.0/69166: 62% mana arcane_charge, crimson_chorus
2:08.700 aoe s arcane_explosion Fluffy_Pillow 39944.4/69166: 58% mana arcane_charge(2), crimson_chorus
2:09.985 aoe r arcane_missiles Fluffy_Pillow 36721.9/69166: 53% mana arcane_charge(3), clearcasting, crimson_chorus
2:11.960 aoe s arcane_explosion Fluffy_Pillow 39454.0/69166: 57% mana arcane_charge(3), crimson_chorus(2), entropic_embrace
2:13.248 aoe o arcane_power Fluffy_Pillow 36235.7/69166: 52% mana arcane_charge(4), crimson_chorus(2), entropic_embrace
2:13.248 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 36235.7/69166: 52% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace
2:13.248 aoe t arcane_barrage Fluffy_Pillow 36235.7/69166: 52% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
2:14.535 aoe s arcane_explosion Fluffy_Pillow 40782.6/69166: 59% mana arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
2:15.822 aoe r arcane_missiles Fluffy_Pillow 40062.9/69166: 58% mana arcane_charge, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
2:17.745 aoe s arcane_explosion Fluffy_Pillow 42723.1/69166: 62% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
2:19.031 aoe s arcane_explosion Fluffy_Pillow 42002.0/69166: 61% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
2:20.318 aoe s arcane_explosion Fluffy_Pillow 41282.3/69166: 60% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
2:21.605 aoe t arcane_barrage Fluffy_Pillow 40562.7/69166: 59% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
2:22.890 shared_cds v use_mana_gem void_elf 45106.8/69166: 65% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:23.079 aoe q arcane_orb Fluffy_Pillow 52284.9/69166: 76% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:24.365 aoe t arcane_barrage Fluffy_Pillow 53813.8/69166: 78% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:25.651 aoe s arcane_explosion Fluffy_Pillow 58359.4/69166: 84% mana arcane_power, crimson_chorus(3), gladiators_badge
2:26.938 aoe s arcane_explosion Fluffy_Pillow 57639.7/69166: 83% mana arcane_charge, arcane_power, crimson_chorus(3), gladiators_badge
2:28.223 aoe s arcane_explosion Fluffy_Pillow 56917.3/69166: 82% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
2:29.511 aoe s arcane_explosion Fluffy_Pillow 56199.0/69166: 81% mana arcane_charge(3), crimson_chorus(3)
2:30.798 aoe t arcane_barrage Fluffy_Pillow 52979.3/69166: 77% mana arcane_charge(4), crimson_chorus(3)
2:32.084 aoe s arcane_explosion Fluffy_Pillow 57524.9/69166: 83% mana
2:33.371 aoe s arcane_explosion Fluffy_Pillow 54305.2/69166: 79% mana arcane_charge
2:34.657 aoe s arcane_explosion Fluffy_Pillow 51084.1/69166: 74% mana arcane_charge(2)
2:35.944 aoe s arcane_explosion Fluffy_Pillow 47864.5/69166: 69% mana arcane_charge(3)
2:37.231 aoe t arcane_barrage Fluffy_Pillow 44644.8/69166: 65% mana arcane_charge(4)
2:38.519 aoe n touch_of_the_magi Fluffy_Pillow 49193.1/69166: 71% mana
2:39.805 aoe p rune_of_power Fluffy_Pillow 48472.1/69166: 70% mana arcane_charge(4)
2:41.090 aoe t arcane_barrage Fluffy_Pillow 50249.6/69166: 73% mana arcane_charge(4), rune_of_power
2:42.378 aoe s arcane_explosion Fluffy_Pillow 54798.0/69166: 79% mana rune_of_power
2:43.665 aoe r arcane_missiles Fluffy_Pillow 51578.3/69166: 75% mana arcane_charge, clearcasting, rune_of_power
2:45.567 aoe s arcane_explosion Fluffy_Pillow 54209.3/69166: 78% mana arcane_charge, rune_of_power
2:46.851 aoe s arcane_explosion Fluffy_Pillow 50985.5/69166: 74% mana arcane_charge(2), rune_of_power
2:48.137 aoe s arcane_explosion Fluffy_Pillow 47764.5/69166: 69% mana arcane_charge(3), rune_of_power
2:49.425 aoe t arcane_barrage Fluffy_Pillow 44546.2/69166: 64% mana arcane_charge(4), rune_of_power
2:50.710 aoe q arcane_orb Fluffy_Pillow 49090.4/69166: 71% mana rune_of_power
2:51.998 aoe t arcane_barrage Fluffy_Pillow 50372.1/69166: 73% mana arcane_charge(4), rune_of_power
2:53.285 aoe s arcane_explosion Fluffy_Pillow 54919.0/69166: 79% mana
2:54.570 aoe s arcane_explosion Fluffy_Pillow 51696.6/69166: 75% mana arcane_charge
2:55.857 aoe s arcane_explosion Fluffy_Pillow 48476.9/69166: 70% mana arcane_charge(2)
2:57.143 aoe r arcane_missiles Fluffy_Pillow 45255.9/69166: 65% mana arcane_charge(3), clearcasting
2:59.165 aoe s arcane_explosion Fluffy_Pillow 48052.9/69166: 69% mana arcane_charge(3)
3:00.451 aoe r arcane_missiles Fluffy_Pillow 44831.9/69166: 65% mana arcane_charge(4), clearcasting
3:02.333 aoe t arcane_barrage Fluffy_Pillow 47435.3/69166: 69% mana arcane_charge(4), crimson_chorus
3:03.621 aoe s arcane_explosion Fluffy_Pillow 51983.6/69166: 75% mana crimson_chorus
3:04.910 aoe s arcane_explosion Fluffy_Pillow 48766.7/69166: 71% mana arcane_charge, crimson_chorus
3:06.197 aoe s arcane_explosion Fluffy_Pillow 45547.0/69166: 66% mana arcane_charge(2), crimson_chorus
3:07.484 aoe r arcane_missiles Fluffy_Pillow 42327.3/69166: 61% mana arcane_charge(3), clearcasting, crimson_chorus
3:09.430 aoe s arcane_explosion Fluffy_Pillow 45019.3/69166: 65% mana arcane_charge(3), crimson_chorus
3:10.715 aoe t arcane_barrage Fluffy_Pillow 41796.8/69166: 60% mana arcane_charge(4), crimson_chorus
3:12.002 aoe q arcane_orb Fluffy_Pillow 46343.8/69166: 67% mana crimson_chorus(2)
3:13.287 aoe t arcane_barrage Fluffy_Pillow 47621.3/69166: 69% mana arcane_charge(4), crimson_chorus(2), entropic_embrace
3:14.574 aoe s arcane_explosion Fluffy_Pillow 52168.3/69166: 75% mana crimson_chorus(2), entropic_embrace
3:15.859 aoe s arcane_explosion Fluffy_Pillow 48945.8/69166: 71% mana arcane_charge, crimson_chorus(2), entropic_embrace
3:17.147 aoe r arcane_missiles Fluffy_Pillow 45727.6/69166: 66% mana arcane_charge(2), clearcasting, crimson_chorus(2), entropic_embrace
3:19.085 aoe s arcane_explosion Fluffy_Pillow 48408.4/69166: 70% mana arcane_charge(2), crimson_chorus(2), entropic_embrace
3:20.371 aoe s arcane_explosion Fluffy_Pillow 45187.4/69166: 65% mana arcane_charge(3), crimson_chorus(2), entropic_embrace
3:21.657 aoe t arcane_barrage Fluffy_Pillow 41966.3/69166: 61% mana arcane_charge(4), crimson_chorus(2), entropic_embrace
3:22.944 aoe s arcane_explosion Fluffy_Pillow 46513.3/69166: 67% mana crimson_chorus(3), entropic_embrace
3:24.231 aoe s arcane_explosion Fluffy_Pillow 43293.6/69166: 63% mana arcane_charge, crimson_chorus(3), entropic_embrace
3:25.517 aoe n touch_of_the_magi Fluffy_Pillow 40072.5/69166: 58% mana arcane_charge(2), crimson_chorus(3)
3:26.803 aoe p rune_of_power Fluffy_Pillow 39351.5/69166: 57% mana arcane_charge(4), crimson_chorus(3)
3:28.089 aoe t arcane_barrage Fluffy_Pillow 41130.4/69166: 59% mana arcane_charge(4), rune_of_power, crimson_chorus(3)
3:29.375 aoe s arcane_explosion Fluffy_Pillow 45676.0/69166: 66% mana rune_of_power, crimson_chorus(3)
3:30.662 aoe s arcane_explosion Fluffy_Pillow 42456.3/69166: 61% mana arcane_charge, rune_of_power, crimson_chorus(3)
3:31.947 aoe s arcane_explosion Fluffy_Pillow 39233.9/69166: 57% mana arcane_charge(2), rune_of_power
3:33.234 aoe s arcane_explosion Fluffy_Pillow 36014.2/69166: 52% mana arcane_charge(3), rune_of_power
3:34.520 aoe t arcane_barrage Fluffy_Pillow 32793.1/69166: 47% mana arcane_charge(4), rune_of_power
3:35.807 aoe q arcane_orb Fluffy_Pillow 37340.1/69166: 54% mana rune_of_power
3:37.093 aoe t arcane_barrage Fluffy_Pillow 38619.0/69166: 56% mana arcane_charge(4), rune_of_power
3:38.380 aoe s arcane_explosion Fluffy_Pillow 43166.0/69166: 62% mana rune_of_power
3:39.668 aoe s arcane_explosion Fluffy_Pillow 39947.7/69166: 58% mana arcane_charge, rune_of_power
3:40.953 aoe s arcane_explosion Fluffy_Pillow 36725.2/69166: 53% mana arcane_charge(2)
3:42.239 aoe r arcane_missiles Fluffy_Pillow 33504.2/69166: 48% mana arcane_charge(3), clearcasting
3:44.129 aoe s arcane_explosion Fluffy_Pillow 36118.7/69166: 52% mana arcane_charge(3)
3:45.414 aoe t arcane_barrage Fluffy_Pillow 32896.2/69166: 48% mana arcane_charge(4)
3:46.701 aoe s arcane_explosion Fluffy_Pillow 37443.2/69166: 54% mana
3:47.988 aoe s arcane_explosion Fluffy_Pillow 34223.5/69166: 49% mana arcane_charge
3:49.275 aoe s arcane_explosion Fluffy_Pillow 31003.8/69166: 45% mana arcane_charge(2)
3:50.561 aoe s arcane_explosion Fluffy_Pillow 27782.8/69166: 40% mana arcane_charge(3)
3:51.848 aoe t arcane_barrage Fluffy_Pillow 24563.1/69166: 36% mana arcane_charge(4)
3:53.135 aoe s arcane_explosion Fluffy_Pillow 29110.0/69166: 42% mana
3:54.421 aoe s arcane_explosion Fluffy_Pillow 25889.0/69166: 37% mana arcane_charge
3:55.707 aoe s arcane_explosion Fluffy_Pillow 22667.9/69166: 33% mana arcane_charge(2)
3:56.993 aoe r arcane_missiles Fluffy_Pillow 19446.9/69166: 28% mana arcane_charge(3), clearcasting
3:58.990 aoe s arcane_explosion Fluffy_Pillow 22209.3/69166: 32% mana arcane_charge(3)
4:00.276 aoe t arcane_barrage Fluffy_Pillow 18988.3/69166: 27% mana arcane_charge(4)
4:01.563 aoe q arcane_orb Fluffy_Pillow 23535.2/69166: 34% mana
4:02.849 aoe t arcane_barrage Fluffy_Pillow 24814.2/69166: 36% mana arcane_charge(4), crimson_chorus
4:04.136 aoe s arcane_explosion Fluffy_Pillow 29361.1/69166: 42% mana crimson_chorus
4:05.423 aoe r arcane_missiles Fluffy_Pillow 26141.5/69166: 38% mana arcane_charge, clearcasting, crimson_chorus
4:07.435 aoe s arcane_explosion Fluffy_Pillow 28924.7/69166: 42% mana arcane_charge, crimson_chorus
4:08.720 aoe s arcane_explosion Fluffy_Pillow 25702.3/69166: 37% mana arcane_charge(2), crimson_chorus
4:10.007 aoe s arcane_explosion Fluffy_Pillow 22482.6/69166: 33% mana arcane_charge(3), crimson_chorus
4:11.294 aoe t arcane_barrage Fluffy_Pillow 19262.9/69166: 28% mana arcane_charge(4), crimson_chorus
4:12.581 aoe n touch_of_the_magi Fluffy_Pillow 23809.9/69166: 34% mana crimson_chorus(2)
4:13.867 aoe o arcane_power Fluffy_Pillow 23088.8/69166: 33% mana arcane_charge(4), crimson_chorus(2)
4:13.867 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 23088.8/69166: 33% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:13.867 aoe t arcane_barrage Fluffy_Pillow 23088.8/69166: 33% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:15.154 aoe s arcane_explosion Fluffy_Pillow 27635.8/69166: 40% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:16.442 aoe r arcane_missiles Fluffy_Pillow 26917.5/69166: 39% mana arcane_charge, arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
4:18.350 aoe s arcane_explosion Fluffy_Pillow 29556.8/69166: 43% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
4:19.635 aoe s arcane_explosion Fluffy_Pillow 28834.4/69166: 42% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
4:20.922 aoe s arcane_explosion Fluffy_Pillow 28114.7/69166: 41% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), entropic_embrace, gladiators_badge
4:22.208 aoe t arcane_barrage Fluffy_Pillow 27393.7/69166: 40% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), entropic_embrace, gladiators_badge
4:23.495 shared_cds v use_mana_gem void_elf 31940.6/69166: 46% mana arcane_power, rune_of_power, crimson_chorus(3), entropic_embrace, gladiators_badge
4:23.495 aoe q arcane_orb Fluffy_Pillow 38857.2/69166: 56% mana arcane_power, rune_of_power, crimson_chorus(3), entropic_embrace, gladiators_badge
4:24.782 aoe t arcane_barrage Fluffy_Pillow 40387.5/69166: 58% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), entropic_embrace, gladiators_badge
4:26.069 aoe s arcane_explosion Fluffy_Pillow 44934.5/69166: 65% mana arcane_power, crimson_chorus(3), entropic_embrace, gladiators_badge
4:27.355 aoe s arcane_explosion Fluffy_Pillow 44213.4/69166: 64% mana arcane_charge, arcane_power, crimson_chorus(3), entropic_embrace, gladiators_badge
4:28.642 aoe s arcane_explosion Fluffy_Pillow 43493.7/69166: 63% mana arcane_charge(2), arcane_power, crimson_chorus(3), entropic_embrace, gladiators_badge
4:29.928 aoe s arcane_explosion Fluffy_Pillow 42772.7/69166: 62% mana arcane_charge(3), crimson_chorus(3)
4:31.213 aoe p rune_of_power Fluffy_Pillow 39550.2/69166: 57% mana arcane_charge(4), crimson_chorus(3)
4:32.498 aoe t arcane_barrage Fluffy_Pillow 41327.8/69166: 60% mana arcane_charge(4), rune_of_power
4:33.786 aoe s arcane_explosion Fluffy_Pillow 45876.1/69166: 66% mana rune_of_power
4:35.071 aoe s arcane_explosion Fluffy_Pillow 42653.7/69166: 62% mana arcane_charge, rune_of_power
4:36.356 aoe s arcane_explosion Fluffy_Pillow 39431.2/69166: 57% mana arcane_charge(2), rune_of_power
4:37.642 aoe s arcane_explosion Fluffy_Pillow 36210.2/69166: 52% mana arcane_charge(3), rune_of_power
4:38.930 aoe r arcane_missiles Fluffy_Pillow 32991.9/69166: 48% mana arcane_charge(4), clearcasting, rune_of_power
4:40.913 aoe t arcane_barrage Fluffy_Pillow 35735.0/69166: 52% mana arcane_charge(4), rune_of_power
4:42.198 aoe s arcane_explosion Fluffy_Pillow 40279.2/69166: 58% mana rune_of_power
4:43.486 aoe s arcane_explosion Fluffy_Pillow 37060.9/69166: 54% mana arcane_charge, rune_of_power
4:44.775 aoe r arcane_missiles Fluffy_Pillow 33844.0/69166: 49% mana arcane_charge(2), clearcasting
4:46.697 aoe s arcane_explosion Fluffy_Pillow 36502.7/69166: 53% mana arcane_charge(2)
4:47.984 aoe r arcane_missiles Fluffy_Pillow 33283.0/69166: 48% mana arcane_charge(3), clearcasting
4:49.998 aoe s arcane_explosion Fluffy_Pillow 36069.0/69166: 52% mana arcane_charge(3)
4:51.283 aoe t arcane_barrage Fluffy_Pillow 32846.6/69166: 47% mana arcane_charge(4)
4:52.568 aoe q arcane_orb Fluffy_Pillow 37390.8/69166: 54% mana
4:53.854 aoe t arcane_barrage Fluffy_Pillow 38669.7/69166: 56% mana arcane_charge(4)
4:55.139 aoe s arcane_explosion Fluffy_Pillow 43213.9/69166: 62% mana
4:56.426 aoe s arcane_explosion Fluffy_Pillow 39994.2/69166: 58% mana arcane_charge
4:57.711 aoe s arcane_explosion Fluffy_Pillow 36771.8/69166: 53% mana arcane_charge(2)
4:58.999 aoe s arcane_explosion Fluffy_Pillow 33553.5/69166: 49% mana arcane_charge(3)
5:00.285 aoe t arcane_barrage Fluffy_Pillow 30332.5/69166: 44% mana arcane_charge(4)
5:01.572 aoe s arcane_explosion Fluffy_Pillow 34879.4/69166: 50% mana

Stats

Level Bonus (60) Race Bonus (void_elf) Raid-Buffed Unbuffed Gear Amount
Strength 198 -3 195 195 0
Agility 306 1 307 307 0
Stamina 414 0 2027 1931 1517
Intellect 450 2 1798 1618 1089 (46)
Spirit 0 0 0 0 0
Health 40540 38620 0
Mana 69166 69166 0
Spell Power 1798 1618 0
Crit 14.34% 14.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="void_elf"
source=default
spec=arcane
level=60
race=void_elf
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

worgen : 8853 dps, 4519 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
8852.8 8852.8 15.7 / 0.178% 1057.8 / 11.9% 4.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2045.6 1943.0 Mana 0.00% 47.9 100.0% 100%
Talents
Runeforge

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worgen 8853
Arcane Barrage 3734 42.2% 50.1 6.02sec 22435 18138 Direct 150.1 6302 12874 7490 18.1%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 50.08 150.05 0.00 0.00 1.2369 0.0000 1123599.74 1123599.74 0.00% 18138.37 18138.37
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.92% 122.93 87 161 6301.73 2168 30681 6292.70 5363 7093 774484 774484 0.00%
crit 18.08% 27.13 13 44 12874.38 4337 61362 12875.44 7522 20014 349115 349115 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [t]:50.08
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Blast 4 0.0% 0.0 0.00sec 0 0 Direct 1.0 908 1817 1054 16.1%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1054.74 1054.74 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 83.90% 0.84 0 1 908.48 908 908 762.21 0 908 762 762 0.00%
crit 16.10% 0.16 0 1 1816.95 1817 1817 292.53 0 1817 293 293 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r
Arcane Explosion 2924 33.0% 129.7 2.29sec 6777 5496 Direct 389.0 1897 3885 2259 18.2%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 129.67 389.02 0.00 0.00 1.2332 0.0000 878812.75 878812.75 0.00% 5495.64 5495.64
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.77% 318.12 230 408 1896.91 1449 3566 1897.10 1791 2022 603322 603322 0.00%
crit 18.23% 70.90 38 105 3885.44 2899 7133 3885.45 3402 4436 275491 275491 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [s]:129.69
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Missiles 994 11.2% 24.2 11.91sec 12366 6507 Periodic 192.6 1307 2660 1551 18.0% 4.4%

Stats Details: Arcane Missiles

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 24.16 0.00 192.75 192.64 1.9005 0.2066 298769.33 298769.33 0.00% 6506.87 6506.87
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 81.98% 157.92 77 250 1307.01 1062 2614 1306.87 1105 1580 206414 206414 0.00%
crit 18.02% 34.71 10 67 2660.34 2125 5228 2658.96 2145 3540 92356 92356 0.00%

Action Details: Arcane Missiles

  • id:5143
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:7500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.50
  • base_tick_time:0.62
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:5143
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.

Action Details: Arcane Missiles Tick

  • id:7268
  • school:arcane
  • range:60.0
  • travel_speed:50.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.405000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:7268
  • name:Arcane Missiles
  • school:arcane
  • tooltip:
  • description:{$@spelldesc5143=Launches five waves of Arcane Missiles at the enemy over {$5143d=2.500 seconds}, causing a total of ${5*{$7268s1=0 + 40.5%}} Arcane damage.}

Action Priority List

    aoe
    [r]:24.15
  • if_expr:buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
Arcane Orb 0 (598) 0.0% (6.7%) 12.7 24.43sec 14110 11379

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.73 0.00 0.00 0.00 1.2400 0.0000 0.00 0.00 0.00% 11379.24 11379.24

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [q]:12.73
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 598 6.7% 38.1 24.43sec 4710 0 Direct 38.1 3953 8051 4711 18.5%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 38.14 38.14 0.00 0.00 0.0000 0.0000 179632.72 179632.72 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.51% 31.09 18 43 3952.61 2864 7048 3952.53 3276 4618 122882 122882 0.00%
crit 18.49% 7.05 0 18 8051.32 5728 14096 8021.64 0 13697 56751 56751 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 15 (24) 0.2% (0.3%) 13.8 1.81sec 512 0 Periodic 40.3 (42.2) 111 0 111 0.0% (0.0%) 4.4%

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.77 0.00 40.29 40.29 0.0000 0.9866 4480.79 4480.79 0.00% 177.51 0.00
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 100.00% 40.29 13 64 111.25 0 202 111.20 70 170 4481 4481 0.00%

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 9 0.1% 1.9 10.00sec 1353 0 Direct 1.9 1115 2227 1353 21.4%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.90 1.90 0.00 0.00 0.0000 0.0000 2575.57 2575.57 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.63% 1.50 0 3 1114.94 1093 1158 1025.63 0 1158 1669 1669 0.00%
crit 21.37% 0.41 0 3 2227.09 2185 2316 817.27 0 2316 906 906 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Eternal Insight 36 0.4% 20.3 14.35sec 534 0 Direct 20.3 452 904 534 18.0%

Stats Details: Eternal Insight

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 20.28 20.28 0.00 0.00 0.0000 0.0000 10824.00 10824.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.97% 16.62 5 30 452.18 444 470 452.16 444 466 7517 7517 0.00%
crit 18.03% 3.66 0 11 904.24 887 941 886.09 0 941 3307 3307 0.00%

Action Details: Eternal Insight

  • id:342314
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:400.00
  • base_dd_max:400.00
  • base_dd_mult:1.00

Spelldata

  • id:342314
  • name:Eternal Insight
  • school:shadow
  • tooltip:
  • description:Deals {$s1=400} Shadow damage.
Mirror Image 0 (14) 0.0% (0.2%) 1.0 0.00sec 4123 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 103  / 14 0.2% 90.0 1.31sec 46 35 Direct 90.0 38 77 46 19.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3272 0.0000 4123.18 4123.18 0.00% 34.52 34.52
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.48% 72.43 60 84 38.17 30 46 38.17 37 39 2765 2765 0.00%
crit 19.52% 17.57 6 30 77.32 59 91 77.27 67 86 1358 1358 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (526) 0.0% (5.9%) 6.2 52.27sec 25453 19785

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 0.00 0.00 0.00 1.2865 0.0000 0.00 0.00 0.00% 19784.91 19784.91

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [n]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 526 5.9% 6.2 52.19sec 25453 0 Direct 18.6 8519 0 8519 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.21 18.56 0.00 0.00 0.0000 0.0000 158022.10 158022.10 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 18.56 15 24 8519.40 237 40341 8510.73 5548 12101 158022 158022 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9730.16
  • base_dd_max:9730.16
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
worgen
Arcane Power 2.9 127.21sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [o]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.5 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.53 0.00 3.14 0.00 4.2166 0.7100 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worgen
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [u]:0.53
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worgen
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worgen
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [w]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.48sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.06 0.00 0.00 0.00 1.2377 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [p]:6.09
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.60sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worgen
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [v]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 50.9 136.9 6.0sec 1.6sec 4.6sec 78.02% 0.00% 3.0 (4.0) 0.0

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 16.1s
  • trigger_min/max:0.0s / 9.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.5s

Stack Uptimes

  • arcane_charge_1:20.63%
  • arcane_charge_2:17.78%
  • arcane_charge_3:16.87%
  • arcane_charge_4:22.74%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.1sec 127.1sec 14.7sec 14.05% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.0s / 140.8s
  • trigger_min/max:120.0s / 140.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.05%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.48% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.48%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.3 0.0 11.9sec 11.9sec 1.3sec 10.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:10.39%
  • clearcasting_2:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Crimson Chorus 5.5 0.0 60.7sec 60.6sec 28.7sec 52.07% 0.00% 0.0 (0.0) 5.0

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_crimson_chorus
  • max_stacks:3
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:60.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:10.00
  • associated item:Cabalist's Hymnal

Stat Details

  • stat:crit_rating
  • amount:95.00

Trigger Details

  • interval_min/max:60.0s / 66.4s
  • trigger_min/max:60.0s / 66.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • crimson_chorus_1:17.95%
  • crimson_chorus_2:17.34%
  • crimson_chorus_3:16.77%

Spelldata

  • id:344803
  • name:Crimson Chorus
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc344806=Join the Crimson Chorus. Every minute, your Critical Strike swells by ${{$s1=44}*3} over ${{$344803d=10 seconds}*3} sec. before returning to normal. This effect is increased by {$s2=5}% for each member of the Crimson Chorus in your party.}
  • max_stacks:3
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Evocation 0.5 0.0 223.0sec 223.0sec 4.2sec 0.74% 0.00% 2.1 (2.1) 0.0

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:223.0s / 223.0s
  • trigger_min/max:223.0s / 223.0s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 4.3s

Stack Uptimes

  • evocation_1:0.75%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Gladiator's Badge 3.9 0.0 86.2sec 86.2sec 14.6sec 19.09% 0.00% 0.0 (0.0) 3.7

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_gladiators_badge
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
  • associated item:Sinful Aspirant's Badge of Ferocity

Stat Details

  • stat:intellect
  • amount:171.00

Trigger Details

  • interval_min/max:60.0s / 140.8s
  • trigger_min/max:60.0s / 140.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • gladiators_badge_1:19.09%

Spelldata

  • id:345228
  • name:Gladiator's Badge
  • tooltip:Primary stat increased by $w1.
  • description:Increases primary stat by {$s1=126} for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.0sec 35.0sec 11.8sec 35.01% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:12.1s / 58.3s
  • trigger_min/max:12.1s / 58.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.01%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Windfury Totem

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_windfury_totem
  • max_stacks:1
  • base duration:900.00
  • duration modifier:1.00
  • base cooldown:0.50
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327942
  • name:Windfury Totem
  • tooltip:Your auto-attacks have a {$h=10}% chance to instantly attack again.
  • description:{$@spelldesc8512=Summons a Windfury Totem with {$s1=5} health at the feet of the caster for {$d=120 seconds}. Party members within {$s2=30} yds have a {$327942h=10}% chance when they auto-attack to swing an extra time.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:10.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Arcane Blast Arcane Charge 0 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.94% 0.76% 5.73% 0.9s 0.0s 5.4s
Conserve Phase 100.00% 100.00% 100.00% 300.8s 240.0s 360.0s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.792120.030239.985
Evocation221.19389.915353.488267.103150.329359.865
Rune of Power6.1370.00029.53438.68416.44176.063
Touch of the Magi4.8710.00047.52231.83614.85969.850
Arcane Power5.0860.00020.84214.8301.86831.144
Arcane Barrage3.5140.00312.228177.755137.597218.063
Arcane Orb4.2110.00018.01154.25029.90293.822

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
worgen
mana_regen Mana 1043.67 405912.81 69.45% 388.93 9583.73 2.31%
Evocation Mana 24.59 27628.39 4.73% 1123.48 0.00 0.00%
Mana Gem Mana 2.74 18919.93 3.24% 6916.57 0.00 0.00%
Arcane Barrage Mana 50.08 132022.11 22.59% 2636.03 6541.09 4.72%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 67790.7 1943.03 2045.60 16114.9 38313.4 191.7 69165.7
Usage Type Count Total Avg RPE APR
worgen
arcane_explosion Mana 129.7 592597.0 4569.5 4569.9 1.5
arcane_orb Mana 12.7 5797.4 455.3 455.4 31.0
touch_of_the_magi Mana 6.2 15509.3 2499.3 2498.1 10.2

Statistics & Data Analysis

Fight Length
worgen Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
worgen Damage Per Second
Count 1118
Mean 8852.75
Minimum 8112.30
Maximum 9704.27
Spread ( max - min ) 1591.97
Range [ ( max - min ) / 2 * 100% ] 8.99%
Standard Deviation 268.1620
5th Percentile 8432.36
95th Percentile 9288.05
( 95th Percentile - 5th Percentile ) 855.70
Mean Distribution
Standard Deviation 8.0200
95.00% Confidence Interval ( 8837.04 - 8868.47 )
Normalized 95.00% Confidence Interval ( 99.82% - 100.18% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3525
0.1 Scale Factor Error with Delta=300 614
0.05 Scale Factor Error with Delta=300 2456
0.01 Scale Factor Error with Delta=300 61388
Priority Target DPS
worgen Priority Target Damage Per Second
Count 1118
Mean 4519.36
Minimum 3761.74
Maximum 5218.97
Spread ( max - min ) 1457.23
Range [ ( max - min ) / 2 * 100% ] 16.12%
Standard Deviation 195.1377
5th Percentile 4215.77
95th Percentile 4842.38
( 95th Percentile - 5th Percentile ) 626.62
Mean Distribution
Standard Deviation 5.8361
95.00% Confidence Interval ( 4507.92 - 4530.80 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 72
0.1% Error 7162
0.1 Scale Factor Error with Delta=300 326
0.05 Scale Factor Error with Delta=300 1301
0.01 Scale Factor Error with Delta=300 32507
DPS(e)
worgen Damage Per Second (Effective)
Count 1118
Mean 8852.75
Minimum 8112.30
Maximum 9704.27
Spread ( max - min ) 1591.97
Range [ ( max - min ) / 2 * 100% ] 8.99%
Damage
worgen Damage
Count 1118
Mean 2657771.74
Minimum 1974187.89
Maximum 3274597.50
Spread ( max - min ) 1300409.61
Range [ ( max - min ) / 2 * 100% ] 24.46%
DTPS
worgen Damage Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
worgen Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
worgen Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
worgen Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
worgen Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
worgen Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
worgenTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
worgen Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=have_opened,op=reset,default=0
4 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
6 0.00 variable,name=final_burn,op=set,value=0
7 0.00 variable,name=rs_max_delay,op=reset,default=5
8 0.00 variable,name=ap_max_delay,op=reset,default=10
9 0.00 variable,name=rop_max_delay,op=reset,default=20
A 0.00 variable,name=totm_max_delay,op=reset,default=5
B 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
C 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
E 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
F 0.00 variable,name=barrage_mana_pct,op=reset,default=100
G 0.00 variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
H 0.00 variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=15
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=inverted_opener,op=reset,default=0
O 0.00 variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
P 0.00 variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
Q 0.00 variable,name=am_spam,op=reset,default=0
R 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
S 0.00 variable,name=evo_pct,op=reset,default=15
T 0.00 flask
U 0.00 food
V 0.00 augmentation
W 0.00 arcane_familiar
X 0.00 arcane_intellect
Y 0.00 conjure_mana_gem
Z 0.00 snapshot_stats
a 0.00 mirror_image
b 0.00 frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
c 0.00 arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
d 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
e 0.00 call_action_list,name=shared_cds
f 0.00 call_action_list,name=essences
g 0.00 call_action_list,name=aoe,if=active_enemies>2
h 0.00 call_action_list,name=opener,if=variable.have_opened<=0
i 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
j 0.00 call_action_list,name=cooldowns
k 0.00 call_action_list,name=rotation,if=variable.final_burn=0
l 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
m 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
n 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
o 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
p 6.09 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
0.00 supernova
q 12.73 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
r 24.15 arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
s 129.69 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
t 50.08 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
u 0.53 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
v 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
w 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up
0.00 use_items,if=buff.arcane_power.up
x 3.95 use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
0.00 use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
0.00 use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
0.00 use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

Sample Sequence

0346789AFHILMNPQSTUYacnowxtqtsssstsssstssssptsrssvstqtsssstssssrtsssstsssstqtssrssrtnptsssstqtsrssstsssstssssrtqtsssstsnptssrsstqtssssoxrtssrsstsvssstqtssrsrstnptsssrstqtsrsssrtsrssrstqtssrssrtnptsssstqtssssrtsrssstsssrstqtsssstnoxtssssvrtqtssssprtsssstsssstqrtssss

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 3 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 6 final_burn Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 7 rs_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 8 ap_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat 9 rop_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat A totm_max_delay Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat F barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat N inverted_opener Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat P ap_on_use Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat Q am_spam Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat S evo_pct Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat T flask worgen 69165.7/69166: 100% mana
Pre precombat U food worgen 69165.7/69166: 100% mana
Pre precombat Y conjure_mana_gem Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat a mirror_image Fluffy_Pillow 69165.7/69166: 100% mana
Pre precombat c arcane_blast Fluffy_Pillow 69165.7/69166: 100% mana
0:00.000 aoe n touch_of_the_magi Fluffy_Pillow 67790.7/69166: 98% mana
0:01.287 aoe o arcane_power Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, crimson_chorus
0:01.287 shared_cds w potion Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus
0:01.287 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation
0:01.287 aoe t arcane_barrage Fluffy_Pillow 66672.6/69166: 96% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:02.277 aoe q arcane_orb Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:03.268 aoe t arcane_barrage Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:04.257 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:05.247 aoe s arcane_explosion Fluffy_Pillow 68035.2/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:06.238 aoe s arcane_explosion Fluffy_Pillow 66906.1/69166: 97% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:07.231 aoe s arcane_explosion Fluffy_Pillow 65779.7/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:08.220 aoe t arcane_barrage Fluffy_Pillow 64647.8/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:09.211 aoe s arcane_explosion Fluffy_Pillow 68785.3/69166: 99% mana bloodlust, arcane_power, rune_of_power, crimson_chorus, potion_of_deathly_fixation, gladiators_badge
0:10.203 aoe s arcane_explosion Fluffy_Pillow 67657.5/69166: 98% mana bloodlust, arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:11.193 aoe s arcane_explosion Fluffy_Pillow 66527.0/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:12.183 aoe s arcane_explosion Fluffy_Pillow 65396.5/69166: 95% mana bloodlust, arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:13.173 aoe t arcane_barrage Fluffy_Pillow 64266.0/69166: 93% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:14.162 aoe s arcane_explosion Fluffy_Pillow 68400.7/69166: 99% mana bloodlust, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:15.152 aoe s arcane_explosion Fluffy_Pillow 67270.2/69166: 97% mana bloodlust, arcane_charge, arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:16.143 aoe s arcane_explosion Fluffy_Pillow 66141.0/69166: 96% mana bloodlust, arcane_charge(2), arcane_power, crimson_chorus(2), potion_of_deathly_fixation, gladiators_badge
0:17.134 aoe s arcane_explosion Fluffy_Pillow 65011.9/69166: 94% mana bloodlust, arcane_charge(3), crimson_chorus(2), potion_of_deathly_fixation
0:18.126 aoe p rune_of_power Fluffy_Pillow 61384.2/69166: 89% mana bloodlust, arcane_charge(4), crimson_chorus(2), potion_of_deathly_fixation
0:19.117 aoe t arcane_barrage Fluffy_Pillow 62755.0/69166: 91% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(2), potion_of_deathly_fixation
0:20.109 aoe s arcane_explosion Fluffy_Pillow 66893.9/69166: 97% mana bloodlust, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:21.101 aoe r arcane_missiles Fluffy_Pillow 63266.1/69166: 91% mana bloodlust, arcane_charge, clearcasting, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:22.631 aoe s arcane_explosion Fluffy_Pillow 65382.6/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:23.621 aoe s arcane_explosion Fluffy_Pillow 61752.1/69166: 89% mana bloodlust, arcane_charge(2), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.612 shared_cds v use_mana_gem worgen 58123.0/69166: 84% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:24.612 aoe s arcane_explosion Fluffy_Pillow 65039.5/69166: 94% mana bloodlust, arcane_charge(3), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:25.603 aoe t arcane_barrage Fluffy_Pillow 61410.4/69166: 89% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3), potion_of_deathly_fixation
0:26.594 aoe q arcane_orb Fluffy_Pillow 65547.9/69166: 95% mana bloodlust, rune_of_power, crimson_chorus(3)
0:27.586 aoe t arcane_barrage Fluffy_Pillow 66420.1/69166: 96% mana bloodlust, arcane_charge(4), rune_of_power, crimson_chorus(3)
0:28.576 aoe s arcane_explosion Fluffy_Pillow 69165.7/69166: 100% mana bloodlust, rune_of_power, crimson_chorus(3)
0:29.567 aoe s arcane_explosion Fluffy_Pillow 65536.6/69166: 95% mana bloodlust, arcane_charge, rune_of_power, crimson_chorus(3)
0:30.558 aoe s arcane_explosion Fluffy_Pillow 61907.4/69166: 90% mana bloodlust, arcane_charge(2), rune_of_power
0:31.547 aoe s arcane_explosion Fluffy_Pillow 58275.5/69166: 84% mana bloodlust, arcane_charge(3)
0:32.536 aoe t arcane_barrage Fluffy_Pillow 54643.6/69166: 79% mana bloodlust, arcane_charge(4)
0:33.526 aoe s arcane_explosion Fluffy_Pillow 58779.7/69166: 85% mana bloodlust
0:34.516 aoe s arcane_explosion Fluffy_Pillow 55149.2/69166: 80% mana bloodlust, arcane_charge
0:35.506 aoe s arcane_explosion Fluffy_Pillow 51518.7/69166: 74% mana bloodlust, arcane_charge(2)
0:36.495 aoe s arcane_explosion Fluffy_Pillow 47886.8/69166: 69% mana bloodlust, arcane_charge(3)
0:37.486 aoe r arcane_missiles Fluffy_Pillow 44257.7/69166: 64% mana bloodlust, arcane_charge(4), clearcasting
0:38.993 aoe t arcane_barrage Fluffy_Pillow 46342.3/69166: 67% mana bloodlust, arcane_charge(4)
0:39.984 aoe s arcane_explosion Fluffy_Pillow 50479.8/69166: 73% mana bloodlust
0:40.973 aoe s arcane_explosion Fluffy_Pillow 46847.9/69166: 68% mana bloodlust, arcane_charge
0:41.964 aoe s arcane_explosion Fluffy_Pillow 43218.8/69166: 62% mana arcane_charge(2)
0:43.251 aoe s arcane_explosion Fluffy_Pillow 39999.1/69166: 58% mana arcane_charge(3)
0:44.537 aoe t arcane_barrage Fluffy_Pillow 36778.1/69166: 53% mana arcane_charge(4)
0:45.823 aoe s arcane_explosion Fluffy_Pillow 41323.6/69166: 60% mana
0:47.111 aoe s arcane_explosion Fluffy_Pillow 38105.3/69166: 55% mana arcane_charge
0:48.395 aoe s arcane_explosion Fluffy_Pillow 34881.5/69166: 50% mana arcane_charge(2)
0:49.681 aoe s arcane_explosion Fluffy_Pillow 31660.4/69166: 46% mana arcane_charge(3)
0:50.966 aoe t arcane_barrage Fluffy_Pillow 28438.0/69166: 41% mana arcane_charge(4)
0:52.253 aoe q arcane_orb Fluffy_Pillow 32985.0/69166: 48% mana
0:53.541 aoe t arcane_barrage Fluffy_Pillow 34266.7/69166: 50% mana arcane_charge(4)
0:54.827 aoe s arcane_explosion Fluffy_Pillow 38812.2/69166: 56% mana
0:56.114 aoe s arcane_explosion Fluffy_Pillow 35592.6/69166: 51% mana arcane_charge
0:57.400 aoe r arcane_missiles Fluffy_Pillow 32371.5/69166: 47% mana arcane_charge(2), clearcasting
0:59.392 aoe s arcane_explosion Fluffy_Pillow 35127.1/69166: 51% mana arcane_charge(2)
1:00.678 aoe s arcane_explosion Fluffy_Pillow 31906.0/69166: 46% mana arcane_charge(3)
1:01.966 aoe r arcane_missiles Fluffy_Pillow 28687.7/69166: 41% mana arcane_charge(4), clearcasting, crimson_chorus
1:03.947 aoe t arcane_barrage Fluffy_Pillow 31428.1/69166: 45% mana arcane_charge(4), crimson_chorus
1:05.233 aoe n touch_of_the_magi Fluffy_Pillow 35973.6/69166: 52% mana crimson_chorus
1:06.519 aoe p rune_of_power Fluffy_Pillow 35252.6/69166: 51% mana arcane_charge(4), crimson_chorus
1:07.806 aoe t arcane_barrage Fluffy_Pillow 37032.9/69166: 54% mana arcane_charge(4), rune_of_power, crimson_chorus
1:09.094 aoe s arcane_explosion Fluffy_Pillow 41581.2/69166: 60% mana rune_of_power, crimson_chorus
1:10.382 aoe s arcane_explosion Fluffy_Pillow 38363.0/69166: 55% mana arcane_charge, rune_of_power, crimson_chorus
1:11.667 aoe s arcane_explosion Fluffy_Pillow 35140.5/69166: 51% mana arcane_charge(2), rune_of_power, crimson_chorus(2)
1:12.953 aoe s arcane_explosion Fluffy_Pillow 31919.5/69166: 46% mana arcane_charge(3), rune_of_power, crimson_chorus(2)
1:14.240 aoe t arcane_barrage Fluffy_Pillow 28699.8/69166: 41% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:15.525 aoe q arcane_orb Fluffy_Pillow 33244.0/69166: 48% mana rune_of_power, crimson_chorus(2)
1:16.813 aoe t arcane_barrage Fluffy_Pillow 34525.7/69166: 50% mana arcane_charge(4), rune_of_power, crimson_chorus(2)
1:18.100 aoe s arcane_explosion Fluffy_Pillow 39072.6/69166: 56% mana rune_of_power, crimson_chorus(2)
1:19.386 aoe r arcane_missiles Fluffy_Pillow 35851.6/69166: 52% mana arcane_charge, clearcasting, rune_of_power, crimson_chorus(2)
1:21.314 aoe s arcane_explosion Fluffy_Pillow 38518.6/69166: 56% mana arcane_charge, crimson_chorus(3)
1:22.601 aoe s arcane_explosion Fluffy_Pillow 35298.9/69166: 51% mana arcane_charge(2), crimson_chorus(3)
1:23.888 aoe s arcane_explosion Fluffy_Pillow 32079.3/69166: 46% mana arcane_charge(3), crimson_chorus(3)
1:25.174 aoe t arcane_barrage Fluffy_Pillow 28858.2/69166: 42% mana arcane_charge(4), crimson_chorus(3)
1:26.462 aoe s arcane_explosion Fluffy_Pillow 33406.5/69166: 48% mana crimson_chorus(3)
1:27.746 aoe s arcane_explosion Fluffy_Pillow 30182.7/69166: 44% mana arcane_charge, crimson_chorus(3)
1:29.033 aoe s arcane_explosion Fluffy_Pillow 26963.0/69166: 39% mana arcane_charge(2), crimson_chorus(3)
1:30.322 aoe s arcane_explosion Fluffy_Pillow 23746.1/69166: 34% mana arcane_charge(3), crimson_chorus(3)
1:31.608 aoe t arcane_barrage Fluffy_Pillow 20525.1/69166: 30% mana arcane_charge(4)
1:32.893 aoe s arcane_explosion Fluffy_Pillow 25069.3/69166: 36% mana
1:34.179 aoe s arcane_explosion Fluffy_Pillow 21848.2/69166: 32% mana arcane_charge
1:35.467 aoe s arcane_explosion Fluffy_Pillow 18629.9/69166: 27% mana arcane_charge(2)
1:36.754 aoe s arcane_explosion Fluffy_Pillow 15410.2/69166: 22% mana arcane_charge(3)
1:38.039 aoe r arcane_missiles Fluffy_Pillow 12187.8/69166: 18% mana arcane_charge(4), clearcasting
1:39.962 aoe t arcane_barrage Fluffy_Pillow 14847.9/69166: 21% mana arcane_charge(4)
1:41.248 aoe q arcane_orb Fluffy_Pillow 19393.5/69166: 28% mana
1:42.535 aoe t arcane_barrage Fluffy_Pillow 20673.8/69166: 30% mana arcane_charge(4)
1:43.824 aoe s arcane_explosion Fluffy_Pillow 25223.5/69166: 36% mana
1:45.111 aoe s arcane_explosion Fluffy_Pillow 22003.8/69166: 32% mana arcane_charge
1:46.397 aoe s arcane_explosion Fluffy_Pillow 18782.8/69166: 27% mana arcane_charge(2)
1:47.682 aoe s arcane_explosion Fluffy_Pillow 15560.3/69166: 22% mana arcane_charge(3)
1:48.970 aoe t arcane_barrage Fluffy_Pillow 12342.1/69166: 18% mana arcane_charge(4)
1:50.258 aoe s arcane_explosion Fluffy_Pillow 16890.4/69166: 24% mana
1:51.544 aoe n touch_of_the_magi Fluffy_Pillow 13669.3/69166: 20% mana arcane_charge
1:52.831 aoe p rune_of_power Fluffy_Pillow 12949.7/69166: 19% mana arcane_charge(4)
1:54.120 aoe t arcane_barrage Fluffy_Pillow 14732.8/69166: 21% mana arcane_charge(4), rune_of_power
1:55.407 aoe s arcane_explosion Fluffy_Pillow 19279.7/69166: 28% mana rune_of_power
1:56.693 aoe s arcane_explosion Fluffy_Pillow 16058.6/69166: 23% mana arcane_charge, rune_of_power
1:57.980 aoe r arcane_missiles Fluffy_Pillow 12839.0/69166: 19% mana arcane_charge(2), clearcasting, rune_of_power
1:59.910 aoe s arcane_explosion Fluffy_Pillow 15508.8/69166: 22% mana arcane_charge(2), rune_of_power
2:01.197 aoe s arcane_explosion Fluffy_Pillow 12289.1/69166: 18% mana arcane_charge(3), rune_of_power
2:02.483 aoe t arcane_barrage Fluffy_Pillow 9068.0/69166: 13% mana arcane_charge(4), rune_of_power, crimson_chorus
2:03.769 aoe q arcane_orb Fluffy_Pillow 13613.6/69166: 20% mana rune_of_power, crimson_chorus
2:05.055 aoe t arcane_barrage Fluffy_Pillow 14892.6/69166: 22% mana arcane_charge(4), rune_of_power, crimson_chorus
2:06.342 aoe s arcane_explosion Fluffy_Pillow 19439.5/69166: 28% mana crimson_chorus
2:07.627 aoe s arcane_explosion Fluffy_Pillow 16217.1/69166: 23% mana arcane_charge, crimson_chorus
2:08.913 aoe s arcane_explosion Fluffy_Pillow 12996.0/69166: 19% mana arcane_charge(2), crimson_chorus
2:10.201 aoe s arcane_explosion Fluffy_Pillow 9777.7/69166: 14% mana arcane_charge(3), crimson_chorus
2:11.487 aoe o arcane_power Fluffy_Pillow 6556.7/69166: 9% mana arcane_charge(4), clearcasting, crimson_chorus(2)
2:11.487 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 6556.7/69166: 9% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2)
2:11.487 aoe r arcane_missiles Fluffy_Pillow 6556.7/69166: 9% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:13.500 aoe t arcane_barrage Fluffy_Pillow 9341.3/69166: 14% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:14.786 aoe s arcane_explosion Fluffy_Pillow 13886.8/69166: 20% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:16.073 aoe s arcane_explosion Fluffy_Pillow 13167.2/69166: 19% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:17.358 aoe r arcane_missiles Fluffy_Pillow 12444.7/69166: 18% mana arcane_charge(2), arcane_power, clearcasting, rune_of_power, crimson_chorus(2), gladiators_badge
2:19.313 aoe s arcane_explosion Fluffy_Pillow 15149.1/69166: 22% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:20.600 aoe s arcane_explosion Fluffy_Pillow 14429.4/69166: 21% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
2:21.887 aoe t arcane_barrage Fluffy_Pillow 13709.8/69166: 20% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:23.174 aoe s arcane_explosion Fluffy_Pillow 18256.7/69166: 26% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
2:24.459 shared_cds v use_mana_gem worgen 17534.3/69166: 25% mana arcane_charge, arcane_power, crimson_chorus(3), gladiators_badge
2:24.612 aoe s arcane_explosion Fluffy_Pillow 24662.5/69166: 36% mana arcane_charge, arcane_power, crimson_chorus(3), gladiators_badge
2:25.897 aoe s arcane_explosion Fluffy_Pillow 23940.0/69166: 35% mana arcane_charge(2), arcane_power, crimson_chorus(3), gladiators_badge
2:27.184 aoe s arcane_explosion Fluffy_Pillow 23220.4/69166: 34% mana arcane_charge(3), crimson_chorus(3)
2:28.472 aoe t arcane_barrage Fluffy_Pillow 20002.1/69166: 29% mana arcane_charge(4), crimson_chorus(3)
2:29.758 aoe q arcane_orb Fluffy_Pillow 24547.6/69166: 35% mana crimson_chorus(3)
2:31.044 aoe t arcane_barrage Fluffy_Pillow 25826.6/69166: 37% mana arcane_charge(4), crimson_chorus(3)
2:32.332 aoe s arcane_explosion Fluffy_Pillow 30374.9/69166: 44% mana
2:33.620 aoe s arcane_explosion Fluffy_Pillow 27156.6/69166: 39% mana arcane_charge
2:34.905 aoe r arcane_missiles Fluffy_Pillow 23934.2/69166: 35% mana arcane_charge(2), clearcasting
2:36.905 aoe s arcane_explosion Fluffy_Pillow 26700.8/69166: 39% mana arcane_charge(2)
2:38.191 aoe r arcane_missiles Fluffy_Pillow 23479.8/69166: 34% mana arcane_charge(3), clearcasting
2:40.207 aoe s arcane_explosion Fluffy_Pillow 26268.5/69166: 38% mana arcane_charge(3)
2:41.494 aoe t arcane_barrage Fluffy_Pillow 23048.9/69166: 33% mana arcane_charge(4)
2:42.781 aoe n touch_of_the_magi Fluffy_Pillow 27595.8/69166: 40% mana
2:44.067 aoe p rune_of_power Fluffy_Pillow 26874.7/69166: 39% mana arcane_charge(4)
2:45.352 aoe t arcane_barrage Fluffy_Pillow 28652.3/69166: 41% mana arcane_charge(4), rune_of_power
2:46.638 aoe s arcane_explosion Fluffy_Pillow 33197.9/69166: 48% mana rune_of_power
2:47.923 aoe s arcane_explosion Fluffy_Pillow 29975.4/69166: 43% mana arcane_charge, rune_of_power
2:49.210 aoe s arcane_explosion Fluffy_Pillow 26755.8/69166: 39% mana arcane_charge(2), rune_of_power
2:50.498 aoe r arcane_missiles Fluffy_Pillow 23537.5/69166: 34% mana arcane_charge(3), clearcasting, rune_of_power
2:52.346 aoe s arcane_explosion Fluffy_Pillow 26093.8/69166: 38% mana arcane_charge(3), rune_of_power
2:53.633 aoe t arcane_barrage Fluffy_Pillow 22874.2/69166: 33% mana arcane_charge(4), rune_of_power
2:54.919 aoe q arcane_orb Fluffy_Pillow 27419.7/69166: 40% mana rune_of_power
2:56.206 aoe t arcane_barrage Fluffy_Pillow 28700.1/69166: 41% mana arcane_charge(4), rune_of_power
2:57.491 aoe s arcane_explosion Fluffy_Pillow 33244.2/69166: 48% mana
2:58.777 aoe r arcane_missiles Fluffy_Pillow 30023.2/69166: 43% mana arcane_charge, clearcasting
3:00.702 aoe s arcane_explosion Fluffy_Pillow 32686.1/69166: 47% mana arcane_charge
3:01.987 aoe s arcane_explosion Fluffy_Pillow 29463.6/69166: 43% mana arcane_charge(2)
3:03.273 aoe s arcane_explosion Fluffy_Pillow 26242.6/69166: 38% mana arcane_charge(3), crimson_chorus
3:04.559 aoe r arcane_missiles Fluffy_Pillow 23021.5/69166: 33% mana arcane_charge(4), clearcasting, crimson_chorus
3:06.599 aoe t arcane_barrage Fluffy_Pillow 25843.5/69166: 37% mana arcane_charge(4), crimson_chorus
3:07.886 aoe s arcane_explosion Fluffy_Pillow 30390.4/69166: 44% mana crimson_chorus
3:09.172 aoe r arcane_missiles Fluffy_Pillow 27169.4/69166: 39% mana arcane_charge, clearcasting, crimson_chorus
3:11.027 aoe s arcane_explosion Fluffy_Pillow 29735.4/69166: 43% mana arcane_charge, crimson_chorus
3:12.314 aoe s arcane_explosion Fluffy_Pillow 26515.7/69166: 38% mana arcane_charge(2), crimson_chorus(2)
3:13.600 aoe r arcane_missiles Fluffy_Pillow 23294.7/69166: 34% mana arcane_charge(3), clearcasting, crimson_chorus(2)
3:15.537 aoe s arcane_explosion Fluffy_Pillow 25974.2/69166: 38% mana arcane_charge(3), crimson_chorus(2)
3:16.823 aoe t arcane_barrage Fluffy_Pillow 22753.1/69166: 33% mana arcane_charge(4), crimson_chorus(2)
3:18.108 aoe q arcane_orb Fluffy_Pillow 27297.3/69166: 39% mana crimson_chorus(2)
3:19.394 aoe t arcane_barrage Fluffy_Pillow 28576.2/69166: 41% mana arcane_charge(4), crimson_chorus(2)
3:20.681 aoe s arcane_explosion Fluffy_Pillow 33123.2/69166: 48% mana crimson_chorus(2)
3:21.968 aoe s arcane_explosion Fluffy_Pillow 29903.5/69166: 43% mana arcane_charge, crimson_chorus(2)
3:23.253 aoe r arcane_missiles Fluffy_Pillow 26681.1/69166: 39% mana arcane_charge(2), clearcasting, crimson_chorus(3)
3:25.257 aoe s arcane_explosion Fluffy_Pillow 29453.2/69166: 43% mana arcane_charge(2), crimson_chorus(3)
3:26.542 aoe s arcane_explosion Fluffy_Pillow 26230.8/69166: 38% mana arcane_charge(3), crimson_chorus(3)
3:27.829 aoe r arcane_missiles Fluffy_Pillow 23011.1/69166: 33% mana arcane_charge(4), clearcasting, crimson_chorus(3)
3:29.719 aoe t arcane_barrage Fluffy_Pillow 25625.6/69166: 37% mana arcane_charge(4), crimson_chorus(3)
3:31.005 aoe n touch_of_the_magi Fluffy_Pillow 30171.2/69166: 44% mana crimson_chorus(3)
3:32.292 aoe p rune_of_power Fluffy_Pillow 29451.5/69166: 43% mana arcane_charge(4)
3:33.579 aoe t arcane_barrage Fluffy_Pillow 31231.8/69166: 45% mana arcane_charge(4), rune_of_power
3:34.865 aoe s arcane_explosion Fluffy_Pillow 35777.4/69166: 52% mana rune_of_power
3:36.152 aoe s arcane_explosion Fluffy_Pillow 32557.7/69166: 47% mana arcane_charge, rune_of_power
3:37.438 aoe s arcane_explosion Fluffy_Pillow 29336.6/69166: 42% mana arcane_charge(2), rune_of_power
3:38.725 aoe s arcane_explosion Fluffy_Pillow 26117.0/69166: 38% mana arcane_charge(3), rune_of_power
3:40.011 aoe t arcane_barrage Fluffy_Pillow 22895.9/69166: 33% mana arcane_charge(4), rune_of_power
3:41.296 aoe q arcane_orb Fluffy_Pillow 27440.1/69166: 40% mana rune_of_power
3:42.582 aoe t arcane_barrage Fluffy_Pillow 28719.0/69166: 42% mana arcane_charge(4), rune_of_power
3:43.868 aoe s arcane_explosion Fluffy_Pillow 33264.6/69166: 48% mana rune_of_power
3:45.154 aoe s arcane_explosion Fluffy_Pillow 30043.6/69166: 43% mana arcane_charge, rune_of_power
3:46.443 aoe s arcane_explosion Fluffy_Pillow 26826.6/69166: 39% mana arcane_charge(2)
3:47.730 aoe s arcane_explosion Fluffy_Pillow 23607.0/69166: 34% mana arcane_charge(3)
3:49.016 aoe r arcane_missiles Fluffy_Pillow 20385.9/69166: 29% mana arcane_charge(4), clearcasting
3:50.981 aoe t arcane_barrage Fluffy_Pillow 23104.1/69166: 33% mana arcane_charge(4)
3:52.267 aoe s arcane_explosion Fluffy_Pillow 27649.7/69166: 40% mana
3:53.553 aoe r arcane_missiles Fluffy_Pillow 24428.6/69166: 35% mana arcane_charge, clearcasting
3:55.421 aoe s arcane_explosion Fluffy_Pillow 27012.7/69166: 39% mana arcane_charge
3:56.707 aoe s arcane_explosion Fluffy_Pillow 23791.6/69166: 34% mana arcane_charge(2)
3:57.992 aoe s arcane_explosion Fluffy_Pillow 20569.2/69166: 30% mana arcane_charge(3)
3:59.278 aoe t arcane_barrage Fluffy_Pillow 17348.1/69166: 25% mana arcane_charge(4)
4:00.565 aoe s arcane_explosion Fluffy_Pillow 21895.1/69166: 32% mana
4:01.850 aoe s arcane_explosion Fluffy_Pillow 18672.6/69166: 27% mana arcane_charge
4:03.137 aoe s arcane_explosion Fluffy_Pillow 15453.0/69166: 22% mana arcane_charge(2)
4:04.423 aoe r arcane_missiles Fluffy_Pillow 12231.9/69166: 18% mana arcane_charge(3), clearcasting, crimson_chorus
4:06.332 aoe s arcane_explosion Fluffy_Pillow 14872.6/69166: 22% mana arcane_charge(3), crimson_chorus
4:07.618 aoe t arcane_barrage Fluffy_Pillow 11651.6/69166: 17% mana arcane_charge(4), crimson_chorus
4:08.905 aoe q arcane_orb Fluffy_Pillow 16198.5/69166: 23% mana crimson_chorus
4:10.191 aoe t arcane_barrage Fluffy_Pillow 17477.5/69166: 25% mana arcane_charge(4), crimson_chorus
4:11.479 aoe s arcane_explosion Fluffy_Pillow 22025.8/69166: 32% mana crimson_chorus
4:12.764 aoe s arcane_explosion Fluffy_Pillow 18803.4/69166: 27% mana arcane_charge, crimson_chorus
4:14.049 aoe s arcane_explosion Fluffy_Pillow 15580.9/69166: 23% mana arcane_charge(2), crimson_chorus(2)
4:15.334 aoe s arcane_explosion Fluffy_Pillow 12358.5/69166: 18% mana arcane_charge(3), crimson_chorus(2)
4:16.621 aoe t arcane_barrage Fluffy_Pillow 9138.8/69166: 13% mana arcane_charge(4), crimson_chorus(2)
4:17.908 aoe n touch_of_the_magi Fluffy_Pillow 13685.8/69166: 20% mana crimson_chorus(2)
4:19.193 aoe o arcane_power Fluffy_Pillow 12963.3/69166: 19% mana arcane_charge(4), crimson_chorus(2)
4:19.193 shared_cds x use_item_sinful_aspirants_badge_of_ferocity Fluffy_Pillow 12963.3/69166: 19% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2)
4:19.193 aoe t arcane_barrage Fluffy_Pillow 12963.3/69166: 19% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:20.480 aoe s arcane_explosion Fluffy_Pillow 17510.3/69166: 25% mana arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:21.770 aoe s arcane_explosion Fluffy_Pillow 16794.8/69166: 24% mana arcane_charge, arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:23.057 aoe s arcane_explosion Fluffy_Pillow 16075.1/69166: 23% mana arcane_charge(2), arcane_power, rune_of_power, crimson_chorus(2), gladiators_badge
4:24.343 aoe s arcane_explosion Fluffy_Pillow 15354.0/69166: 22% mana arcane_charge(3), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.630 shared_cds v use_mana_gem worgen 14634.4/69166: 21% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
4:25.630 aoe r arcane_missiles Fluffy_Pillow 21550.9/69166: 31% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, crimson_chorus(3), gladiators_badge
4:27.581 aoe t arcane_barrage Fluffy_Pillow 24249.8/69166: 35% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:28.868 aoe q arcane_orb Fluffy_Pillow 28796.7/69166: 42% mana arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:30.192 aoe t arcane_barrage Fluffy_Pillow 30378.2/69166: 44% mana arcane_charge(4), arcane_power, rune_of_power, crimson_chorus(3), gladiators_badge
4:31.478 aoe s arcane_explosion Fluffy_Pillow 34923.8/69166: 50% mana arcane_power, crimson_chorus(3), gladiators_badge
4:32.763 aoe s arcane_explosion Fluffy_Pillow 34201.4/69166: 49% mana arcane_charge, arcane_power, crimson_chorus(3), gladiators_badge
4:34.052 aoe s arcane_explosion Fluffy_Pillow 33484.5/69166: 48% mana arcane_charge(2), arcane_power, gladiators_badge
4:35.338 aoe s arcane_explosion Fluffy_Pillow 32763.4/69166: 47% mana arcane_charge(3)
4:36.626 aoe p rune_of_power Fluffy_Pillow 29545.1/69166: 43% mana arcane_charge(4), clearcasting
4:37.913 aoe r arcane_missiles Fluffy_Pillow 31325.4/69166: 45% mana arcane_charge(4), clearcasting, rune_of_power
4:39.936 aoe t arcane_barrage Fluffy_Pillow 34123.9/69166: 49% mana arcane_charge(4), rune_of_power
4:41.223 aoe s arcane_explosion Fluffy_Pillow 38670.8/69166: 56% mana rune_of_power
4:42.509 aoe s arcane_explosion Fluffy_Pillow 35449.8/69166: 51% mana arcane_charge, rune_of_power
4:43.797 aoe s arcane_explosion Fluffy_Pillow 32231.5/69166: 47% mana arcane_charge(2), rune_of_power
4:45.086 aoe s arcane_explosion Fluffy_Pillow 29014.6/69166: 42% mana arcane_charge(3), rune_of_power
4:46.372 aoe t arcane_barrage Fluffy_Pillow 25793.5/69166: 37% mana arcane_charge(4), rune_of_power
4:47.660 aoe s arcane_explosion Fluffy_Pillow 30341.9/69166: 44% mana rune_of_power
4:48.946 aoe s arcane_explosion Fluffy_Pillow 27120.8/69166: 39% mana arcane_charge, rune_of_power
4:50.233 aoe s arcane_explosion Fluffy_Pillow 23901.1/69166: 35% mana arcane_charge(2)
4:51.519 aoe s arcane_explosion Fluffy_Pillow 20680.1/69166: 30% mana arcane_charge(3)
4:52.805 aoe t arcane_barrage Fluffy_Pillow 17459.0/69166: 25% mana arcane_charge(4)
4:54.091 aoe q arcane_orb Fluffy_Pillow 22004.6/69166: 32% mana
4:55.378 aoe r arcane_missiles Fluffy_Pillow 23284.9/69166: 34% mana arcane_charge(4), clearcasting
4:57.299 aoe t arcane_barrage Fluffy_Pillow 25942.3/69166: 38% mana arcane_charge(4)
4:58.585 aoe s arcane_explosion Fluffy_Pillow 30487.8/69166: 44% mana
4:59.874 aoe s arcane_explosion Fluffy_Pillow 27270.9/69166: 39% mana arcane_charge
5:01.160 aoe s arcane_explosion Fluffy_Pillow 24049.9/69166: 35% mana arcane_charge(2)
5:02.446 aoe s arcane_explosion Fluffy_Pillow 20828.8/69166: 30% mana arcane_charge(3)

Stats

Level Bonus (60) Race Bonus (worgen) Raid-Buffed Unbuffed Gear Amount
Strength 198 2 200 200 0
Agility 306 1 307 307 0
Stamina 414 0 2027 1931 1517
Intellect 450 -3 1792 1612 1089 (46)
Spirit 0 0 0 0 0
Health 40540 38620 0
Mana 69166 69166 0
Spell Power 1792 1612 0
Crit 15.34% 15.34% 327
Haste 17.00% 17.00% 561
Versatility 5.65% 5.65% 226
Mana Regen 1383 1383 0
Mastery 38.33% 38.33% 838
Armor 369 369 369
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 227.00
Local Head Confidant's Favored Cap
ilevel: 226, stats: { 44 Armor, +82 Int, +149 Sta, +44 Haste, +98 Mastery }
Local Neck Noble's Birthstone Pendant
ilevel: 226, stats: { +84 Sta, +52 Crit, +162 Mastery }
Local Shoulders Shawl of the Penitent
ilevel: 233, stats: { 42 Armor, +65 Int, +122 Sta, +33 Crit, +76 Haste }
Local Chest Robes of the Cursed Commando
ilevel: 233, stats: { 61 Armor, +87 Int, +162 Sta, +47 Crit, +100 Haste }, enchant: { +20 Int }
Local Waist Cinch of Infinite Tightness
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +69 Crit, +36 Vers }
Local Legs Courtier's Costume Trousers
ilevel: 226, stats: { 51 Armor, +82 Int, +149 Sta, +49 Vers, +93 Mastery }
Local Feet Slippers of the Forgotten Heretic
ilevel: 226, stats: { 36 Armor, +61 Int, +112 Sta, +73 Crit, +32 Mastery }
Local Wrists Acolyte's Velvet Bindings
ilevel: 226, stats: { 29 Armor, +46 Int, +84 Sta, +26 Vers, +53 Mastery }, enchant: { +15 Int }
Local Hands Impossibly Oversized Mitts
ilevel: 226, stats: { 33 Armor, +61 Int, +112 Sta, +31 Haste, +74 Mastery }
Local Finger1 Most Regal Signet of Sire Denathrius
ilevel: 233, stats: { +91 Sta, +178 Haste, +48 Mastery }, enchant: { +16 Mastery }
item effects: { equip: Denathrius' Privilege }
Local Finger2 Shadowghast Ring
ilevel: 235, stats: { +94 Sta, +115 Mastery, +115 Vers }, enchant: { +16 Mastery }
item effects: { equip: Arcane Bombardment }
Local Trinket1 Cabalist's Hymnal
ilevel: 226, stats: { +77 Int }
item effects: { equip: Crimson Chorus }
Local Trinket2 Sinful Aspirant's Badge of Ferocity
ilevel: 207, stats: { +91 Haste }
item effects: { use: Gladiator's Badge }
Local Back Mantle of Manifest Sins
ilevel: 226, stats: { 40 Armor, +84 Sta, +53 Crit, +26 Mastery, +46 StrAgiInt }
Local Main Hand Spire of the Long Dark
ilevel: 233, weapon: { 99 - 136, 3.6 }, stats: { +87 Int, +299 Int, +162 Sta, +41 Haste, +105 Mastery }, enchant: sinful_revelation

Profile

mage="worgen"
source=default
spec=arcane
level=60
race=worgen
role=spell
position=back
talents=1031021
talent_override=resonance,if=3>2

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=100
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(60-(mastery_value*100)),if=variable.barrage_mana_pct=100&covenant.night_fae.enabled
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=(80-(mastery_value*100)),if=variable.barrage_mana_pct=100
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=15
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=inverted_opener,op=reset,default=0
actions.precombat+=/variable,name=inverted_opener,op=set,value=1,if=variable.inverted_opener=0&talent.rune_of_power.enabled&talent.arcane_echo.enabled
actions.precombat+=/variable,name=ap_on_use,op=set,value=equipped.macabre_sheet_music|equipped.gladiators_badge|equipped.gladiators_medallion|equipped.darkmoon_deck_putrescence|equipped.inscrutable_quantum_device|equipped.soulletting_ruby|equipped.sunblood_amethyst|equipped.wakeners_frond|equipped.flame_of_battle
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0&runeforge.disciplinary_command.equipped
actions.precombat+=/arcane_blast,if=variable.prepull_evo<=0&!runeforge.disciplinary_command.equipped
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/deathborne,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(buff.rune_of_power.down&(cooldown.touch_of_the_magi.remains>variable.ap_max_delay|cooldown.touch_of_the_magi.remains=0))
actions.am_spam+=/radiant_spark
actions.am_spam+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)&(!runeforge.arcane_bombardment.equipped|target.health.pct>35)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<8
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&(runeforge.arcane_infinity.equipped|talent.amplification.enabled)&active_enemies<5
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation&!runeforge.siphon_storm.equipped
actions.opener+=/variable,name=have_opened,op=set,value=1,if=buff.arcane_power.down&cooldown.arcane_power.remains>0&runeforge.siphon_storm.equipped
actions.opener+=/evocation,if=runeforge.siphon_storm.equipped&talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0&(buff.rune_of_power.down|prev_gcd.1.arcane_barrage)
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/deathborne,if=!runeforge.siphon_storm.equipped
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/arcane_orb,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0
actions.opener+=/arcane_blast,if=variable.inverted_opener=1&cooldown.rune_of_power.remains=0&buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.opener+=/rune_of_power,if=variable.inverted_opener=1&buff.rune_of_power.down
actions.opener+=/deathborne,if=buff.rune_of_power.down
actions.opener+=/mirrors_of_torment,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/touch_of_the_magi,if=buff.rune_of_power.down|prev_gcd.1.arcane_barrage
actions.opener+=/arcane_power,if=prev_gcd.1.touch_of_the_magi
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind,if=debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<action.arcane_missiles.execute_time
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_barrage,if=buff.rune_of_power.up&cooldown.arcane_power.remains=0&mana.pct<30&!runeforge.siphon_storm.equipped
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&cooldown.arcane_power.remains>0,chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/cancel_action,if=action.evocation.channeling&mana.pct>=95&(!runeforge.siphon_storm.equipped|buff.siphon_storm.stack=buff.siphon_storm.max_stack)
actions.rotation+=/evocation,if=mana.pct<=variable.evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/evocation,if=runeforge.siphon_storm.equipped&cooldown.arcane_power.remains<=action.evocation.execute_time
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|(!talent.overpowered.enabled&(buff.rune_of_power.up|cooldown.evocation.ready)))
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up&(cooldown.arcane_power.remains=0|fight_remains<=40)
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/use_item,effect_name=gladiators_badge,if=buff.arcane_power.up|cooldown.arcane_power.remains>=55&debuff.touch_of_the_magi.up
actions.shared_cds+=/use_item,name=empyreal_ordnance,if=cooldown.arcane_power.remains<=20
actions.shared_cds+=/use_item,name=dreadfire_vessel,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=soul_igniter,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=glyph_of_assimilation,if=cooldown.arcane_power.remains>=20|!variable.ap_on_use=1|(time=0&variable.inverted_opener=1&runeforge.siphon_storm.equipped)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&(!variable.inverted_opener=1|time>30)
actions.shared_cds+=/use_item,name=macabre_sheet_music,if=cooldown.arcane_power.remains<=5&variable.inverted_opener=1&buff.rune_of_power.up&buff.rune_of_power.remains<=(10-5*runeforge.siphon_storm.equipped)&time<30

head=confidants_favored_cap,id=183021,bonus_id=1498,ilevel=226
neck=nobles_birthstone_pendant,id=183039,bonus_id=1498,ilevel=226
shoulders=shawl_of_the_penitent,id=183020,bonus_id=1498,ilevel=233
back=mantle_of_manifest_sins,id=183033,bonus_id=1498,ilevel=226
chest=robes_of_the_cursed_commando,id=182998,bonus_id=1498,ilevel=233,enchant=eternal_insight
wrists=acolytes_velvet_bindings,id=183017,bonus_id=1498,ilevel=226,enchant=eternal_intellect
hands=impossibly_oversized_mitts,id=183022,bonus_id=1498,ilevel=226
waist=cinch_of_infinite_tightness,id=183028,bonus_id=1498,ilevel=226
legs=courtiers_costume_trousers,id=183011,bonus_id=1498,ilevel=226
feet=slippers_of_the_forgotten_heretic,id=182979,bonus_id=1498,ilevel=226
finger1=most_regal_signet_of_sire_denathrius,id=183036,bonus_id=1498,ilevel=233,enchant=16mastery
finger2=shadowghast_ring,id=178926,bonus_id=6648/6650/6758/6927/1532,ilevel=235,enchant=16mastery
trinket1=cabalists_hymnal,id=184028,bonus_id=1498,ilevel=226
trinket2=sinful_aspirants_badge_of_ferocity,id=175884,bonus_id=1521,ilevel=207
main_hand=spire_of_the_long_dark,id=180002,bonus_id=7187/6652/1531,ilevel=233,enchant=sinful_revelation

# Gear Summary
# gear_ilvl=227.20
# gear_stamina=1517
# gear_intellect=1089
# gear_crit_rating=327
# gear_haste_rating=561
# gear_mastery_rating=838
# gear_versatility_rating=226
# gear_armor=369

Simulation & Raid Information

Iterations: 1134
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.8 )

Performance:

Total Events Processed: 52632013
Max Event Queue: 428
Sim Seconds: 341098
CPU Seconds: 80.0312
Physical Seconds: 13.5516
Speed Up: 4262

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
arcane arcane arcane_barrage 44425 1123790 3736 30.13 6316 12942 50.4 151.1 17.0% 0.0% 0.0% 0.0% 5.98sec 1123790 300.79sec
arcane arcane arcane_blast 30451 1047 3 0.20 908 1817 0.0 1.0 15.2% 0.0% 0.0% 0.0% 0.00sec 1047 300.79sec
arcane arcane arcane_explosion 1449 887957 2952 78.25 1916 3935 130.8 392.3 17.2% 0.0% 0.0% 0.0% 2.28sec 887957 300.79sec
arcane arcane arcane_missiles ticks -5143 304199 1014 39.21 1320 2688 24.6 196.0 17.0% 0.0% 0.0% 0.0% 11.77sec 304199 300.79sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.32sec 0 300.79sec
arcane arcane arcane_orb_bolt 153640 177410 590 7.61 3935 8073 38.1 38.1 17.3% 0.0% 0.0% 0.0% 24.32sec 177410 300.79sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 126.78sec 0 300.79sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 253.35sec 0 300.79sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
arcane arcane deathly_fixation ticks -322253 4598 15 8.25 111 0 14.6 41.3 0.0% 0.0% 0.0% 0.0% 1.71sec 4598 300.79sec
arcane arcane deathly_eruption 322256 2774 9 0.41 1113 2231 2.1 2.1 20.2% 0.0% 0.0% 0.0% 9.41sec 2774 300.79sec
arcane arcane eternal_insight 342314 10815 36 4.09 452 903 20.5 20.5 16.7% 0.0% 0.0% 0.0% 14.38sec 10815 300.79sec
arcane arcane evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
arcane arcane_mirror_image frostbolt 59638 4241 106 139.50 38 78 93.0 93.0 18.5% 0.0% 0.0% 0.0% 1.27sec 4241 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.24sec 0 300.79sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.79sec 0 300.79sec
arcane arcane touch_of_the_magi_explosion 210833 159461 530 3.72 8555 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.68sec 159461 300.79sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.31sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf arcane_barrage 44425 1136684 3779 29.91 6414 13235 50.0 149.9 17.1% 0.0% 0.0% 0.0% 6.02sec 1136684 300.79sec
dark_iron_dwarf dark_iron_dwarf arcane_blast 30451 1046 3 0.20 909 1819 0.0 1.0 15.0% 0.0% 0.0% 0.0% 0.00sec 1046 300.79sec
dark_iron_dwarf dark_iron_dwarf arcane_explosion 1449 884591 2941 77.47 1930 3955 129.5 388.4 17.2% 0.0% 0.0% 0.0% 2.29sec 884591 300.79sec
dark_iron_dwarf dark_iron_dwarf arcane_missiles ticks -5143 303154 1011 39.02 1323 2703 24.5 195.1 16.8% 0.0% 0.0% 0.0% 11.94sec 303154 300.79sec
dark_iron_dwarf dark_iron_dwarf arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.36sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf arcane_orb_bolt 153640 181536 604 7.60 4034 8270 38.1 38.1 17.3% 0.0% 0.0% 0.0% 24.35sec 181536 300.79sec
dark_iron_dwarf dark_iron_dwarf arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.34sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf deathly_fixation ticks -322253 4540 15 8.14 111 0 13.9 40.7 0.0% 0.0% 0.0% 0.0% 1.80sec 4540 300.79sec
dark_iron_dwarf dark_iron_dwarf deathly_eruption 322256 2592 9 0.38 1114 2231 1.9 1.9 21.0% 0.0% 0.0% 0.0% 9.71sec 2592 300.79sec
dark_iron_dwarf dark_iron_dwarf eternal_insight 342314 10714 36 4.04 452 905 20.3 20.3 17.0% 0.0% 0.0% 0.0% 14.41sec 10714 300.79sec
dark_iron_dwarf dark_iron_dwarf evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 184.63sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf fireblood 265221 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.34sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf_mirror_image frostbolt 59638 4188 105 135.00 39 79 90.0 90.0 18.4% 0.0% 0.0% 0.0% 1.31sec 4188 40.00sec
dark_iron_dwarf dark_iron_dwarf potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.33sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.14sec 0 300.79sec
dark_iron_dwarf dark_iron_dwarf touch_of_the_magi_explosion 210833 165075 549 3.70 8906 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 52.03sec 165075 300.79sec
dark_iron_dwarf dark_iron_dwarf use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.94sec 0 300.79sec
draenei draenei arcane_barrage 44425 1132546 3765 29.95 6407 13057 50.1 150.2 17.1% 0.0% 0.0% 0.0% 6.01sec 1132546 300.79sec
draenei draenei arcane_blast 30451 1059 4 0.20 923 1846 0.0 1.0 14.8% 0.0% 0.0% 0.0% 0.00sec 1059 300.79sec
draenei draenei arcane_explosion 1449 884809 2942 77.59 1927 3943 129.7 389.0 17.2% 0.0% 0.0% 0.0% 2.29sec 884809 300.79sec
draenei draenei arcane_missiles ticks -5143 301145 1004 38.61 1327 2706 24.2 193.1 17.0% 0.0% 0.0% 0.0% 11.95sec 301145 300.79sec
draenei draenei arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.37sec 0 300.79sec
draenei draenei arcane_orb_bolt 153640 180811 601 7.61 4014 8217 38.1 38.1 17.3% 0.0% 0.0% 0.0% 24.37sec 180811 300.79sec
draenei draenei arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.08sec 0 300.79sec
draenei draenei conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
draenei draenei deathly_fixation ticks -322253 4541 15 8.04 113 0 14.0 40.2 0.0% 0.0% 0.0% 0.0% 1.79sec 4541 300.79sec
draenei draenei deathly_eruption 322256 2607 9 0.39 1115 2227 1.9 1.9 20.5% 0.0% 0.0% 0.0% 9.47sec 2607 300.79sec
draenei draenei eternal_insight 342314 10707 36 4.01 452 904 20.1 20.1 17.8% 0.0% 0.0% 0.0% 14.57sec 10707 300.79sec
draenei draenei evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
draenei draenei flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
draenei draenei food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
draenei draenei mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
draenei draenei_mirror_image frostbolt 59638 4152 104 135.00 39 79 90.0 90.0 18.5% 0.0% 0.0% 0.0% 1.31sec 4152 40.00sec
draenei draenei potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
draenei draenei rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.20sec 0 300.79sec
draenei draenei touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.94sec 0 300.79sec
draenei draenei touch_of_the_magi_explosion 210833 158645 527 3.70 8557 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.83sec 158645 300.79sec
draenei draenei use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.52sec 0 300.79sec
dwarf dwarf arcane_barrage 44425 1121621 3729 29.89 6305 13173 50.0 149.8 17.2% 0.0% 0.0% 0.0% 6.03sec 1121621 300.79sec
dwarf dwarf arcane_blast 30451 1052 3 0.20 909 1855 0.0 1.0 15.1% 0.0% 0.0% 0.0% 0.00sec 1052 300.79sec
dwarf dwarf arcane_explosion 1449 875518 2911 77.44 1898 3974 129.4 388.2 17.2% 0.0% 0.0% 0.0% 2.29sec 875518 300.79sec
dwarf dwarf arcane_missiles ticks -5143 303554 1012 39.12 1313 2727 24.5 195.6 17.0% 0.0% 0.0% 0.0% 11.79sec 303554 300.79sec
dwarf dwarf arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.45sec 0 300.79sec
dwarf dwarf arcane_orb_bolt 153640 178584 594 7.61 3949 8243 38.1 38.1 17.1% 0.0% 0.0% 0.0% 24.45sec 178584 300.79sec
dwarf dwarf arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.19sec 0 300.79sec
dwarf dwarf conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dwarf dwarf deathly_fixation ticks -322253 4541 15 8.12 112 0 13.8 40.6 0.0% 0.0% 0.0% 0.0% 1.79sec 4541 300.79sec
dwarf dwarf deathly_eruption 322256 2614 9 0.38 1115 2275 1.9 1.9 21.4% 0.0% 0.0% 0.0% 9.41sec 2614 300.79sec
dwarf dwarf eternal_insight 342314 10925 36 4.09 452 922 20.5 20.5 17.2% 0.0% 0.0% 0.0% 14.31sec 10925 300.79sec
dwarf dwarf evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dwarf dwarf flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dwarf dwarf food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dwarf dwarf mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dwarf dwarf_mirror_image frostbolt 59638 4109 103 135.00 38 79 90.0 90.0 18.2% 0.0% 0.0% 0.0% 1.31sec 4109 40.00sec
dwarf dwarf potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
dwarf dwarf rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.30sec 0 300.79sec
dwarf dwarf touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.07sec 0 300.79sec
dwarf dwarf touch_of_the_magi_explosion 210833 157917 525 3.71 8507 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.97sec 157917 300.79sec
dwarf dwarf use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.06sec 0 300.79sec
gnome gnome arcane_barrage 44425 1125525 3742 30.17 6312 12911 50.5 151.2 17.1% 0.0% 0.0% 0.0% 5.97sec 1125525 300.79sec
gnome gnome arcane_blast 30451 1047 3 0.20 912 1824 0.0 1.0 14.8% 0.0% 0.0% 0.0% 0.00sec 1047 300.79sec
gnome gnome arcane_explosion 1449 883734 2938 78.48 1902 3904 131.1 393.4 17.2% 0.0% 0.0% 0.0% 2.26sec 883734 300.79sec
gnome gnome arcane_missiles ticks -5143 306848 1023 39.58 1316 2689 24.8 197.9 17.2% 0.0% 0.0% 0.0% 11.64sec 306848 300.79sec
gnome gnome arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.14sec 0 300.79sec
gnome gnome arcane_orb_bolt 153640 179838 598 7.68 3962 8108 38.5 38.5 17.2% 0.0% 0.0% 0.0% 24.14sec 179838 300.79sec
gnome gnome arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 126.89sec 0 300.79sec
gnome gnome conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
gnome gnome deathly_fixation ticks -322253 4501 15 8.08 111 0 14.0 40.4 0.0% 0.0% 0.0% 0.0% 1.77sec 4501 300.79sec
gnome gnome deathly_eruption 322256 2610 9 0.39 1115 2232 2.0 2.0 19.2% 0.0% 0.0% 0.0% 9.66sec 2610 300.79sec
gnome gnome eternal_insight 342314 10742 36 4.05 452 905 20.3 20.3 17.1% 0.0% 0.0% 0.0% 14.29sec 10742 300.79sec
gnome gnome evocation 12051 0 0 0.00 0 0 0.4 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
gnome gnome flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
gnome gnome food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
gnome gnome mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
gnome gnome_mirror_image frostbolt 59638 4097 102 135.00 38 78 90.0 90.0 18.2% 0.0% 0.0% 0.0% 1.30sec 4097 40.00sec
gnome gnome potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
gnome gnome rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.08sec 0 300.79sec
gnome gnome touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.78sec 0 300.79sec
gnome gnome touch_of_the_magi_explosion 210833 158552 527 3.71 8518 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.66sec 158552 300.79sec
gnome gnome use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.22sec 0 300.79sec
human human arcane_barrage 44425 1123157 3734 29.96 6311 13059 50.1 150.2 17.3% 0.0% 0.0% 0.0% 6.02sec 1123157 300.79sec
human human arcane_blast 30451 1051 3 0.20 911 1822 0.0 1.0 15.4% 0.0% 0.0% 0.0% 0.00sec 1051 300.79sec
human human arcane_explosion 1449 880675 2928 77.77 1909 3910 130.0 389.9 17.5% 0.0% 0.0% 0.0% 2.29sec 880675 300.79sec
human human arcane_missiles ticks -5143 304043 1013 39.13 1318 2680 24.5 195.7 17.3% 0.0% 0.0% 0.0% 11.69sec 304043 300.79sec
human human arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.33sec 0 300.79sec
human human arcane_orb_bolt 153640 179002 595 7.61 3971 8100 38.2 38.2 17.4% 0.0% 0.0% 0.0% 24.33sec 179002 300.79sec
human human arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.20sec 0 300.79sec
human human conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
human human deathly_fixation ticks -322253 4560 15 8.08 113 0 14.0 40.4 0.0% 0.0% 0.0% 0.0% 1.81sec 4560 300.79sec
human human deathly_eruption 322256 2623 9 0.39 1115 2229 2.0 2.0 20.5% 0.0% 0.0% 0.0% 9.69sec 2623 300.79sec
human human eternal_insight 342314 10832 36 4.06 453 905 20.3 20.3 17.7% 0.0% 0.0% 0.0% 14.22sec 10832 300.79sec
human human evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
human human flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
human human food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
human human mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
human human_mirror_image frostbolt 59638 4111 103 135.00 38 78 90.0 90.0 18.8% 0.0% 0.0% 0.0% 1.31sec 4111 40.00sec
human human potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
human human rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.27sec 0 300.79sec
human human touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.96sec 0 300.79sec
human human touch_of_the_magi_explosion 210833 157782 525 3.70 8504 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.86sec 157782 300.79sec
human human use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 122.75sec 0 300.79sec
kul_tiran kul_tiran arcane_barrage 44425 1124556 3739 29.89 6348 13118 50.0 149.8 17.1% 0.0% 0.0% 0.0% 6.01sec 1124556 300.79sec
kul_tiran kul_tiran arcane_blast 30451 1050 3 0.20 918 1836 0.0 1.0 14.4% 0.0% 0.0% 0.0% 0.00sec 1050 300.79sec
kul_tiran kul_tiran arcane_explosion 1449 879705 2925 77.51 1916 3934 129.5 388.6 17.3% 0.0% 0.0% 0.0% 2.29sec 879705 300.79sec
kul_tiran kul_tiran arcane_missiles ticks -5143 303116 1010 38.94 1325 2696 24.4 194.7 16.9% 0.0% 0.0% 0.0% 12.13sec 303116 300.79sec
kul_tiran kul_tiran arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.31sec 0 300.79sec
kul_tiran kul_tiran arcane_orb_bolt 153640 178905 595 7.58 3992 8132 38.0 38.0 17.2% 0.0% 0.0% 0.0% 24.31sec 178905 300.79sec
kul_tiran kul_tiran arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.15sec 0 300.79sec
kul_tiran kul_tiran conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
kul_tiran kul_tiran deathly_fixation ticks -322253 4660 16 8.16 114 0 13.9 40.8 0.0% 0.0% 0.0% 0.0% 1.80sec 4660 300.79sec
kul_tiran kul_tiran deathly_eruption 322256 2612 9 0.38 1124 2250 1.9 1.9 21.6% 0.0% 0.0% 0.0% 9.63sec 2612 300.79sec
kul_tiran kul_tiran eternal_insight 342314 10915 36 4.06 456 913 20.4 20.4 17.5% 0.0% 0.0% 0.0% 14.40sec 10915 300.79sec
kul_tiran kul_tiran evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 220.79sec 0 300.79sec
kul_tiran kul_tiran flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
kul_tiran kul_tiran food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
kul_tiran kul_tiran mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
kul_tiran kul_tiran_mirror_image frostbolt 59638 4129 103 135.00 39 78 90.0 90.0 18.4% 0.0% 0.0% 0.0% 1.31sec 4129 40.00sec
kul_tiran kul_tiran potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
kul_tiran kul_tiran rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.39sec 0 300.79sec
kul_tiran kul_tiran touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.23sec 0 300.79sec
kul_tiran kul_tiran touch_of_the_magi_explosion 210833 158198 526 3.70 8526 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 52.13sec 158198 300.79sec
kul_tiran kul_tiran use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.27sec 0 300.79sec
lightforged draenei lightforged draenei arcane_barrage 44425 1108336 3685 29.66 6337 12871 49.6 148.7 17.1% 0.0% 0.0% 0.0% 6.06sec 1108336 300.79sec
lightforged draenei lightforged draenei arcane_blast 30451 1033 3 0.20 910 1820 0.0 1.0 13.5% 0.0% 0.0% 0.0% 0.00sec 1033 300.79sec
lightforged draenei lightforged draenei arcane_explosion 1449 863647 2871 76.65 1902 3917 128.1 384.3 17.2% 0.0% 0.0% 0.0% 2.31sec 863647 300.79sec
lightforged draenei lightforged draenei arcane_missiles ticks -5143 298470 995 38.55 1316 2690 24.2 192.7 17.0% 0.0% 0.0% 0.0% 12.09sec 298470 300.79sec
lightforged draenei lightforged draenei arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.45sec 0 300.79sec
lightforged draenei lightforged draenei arcane_orb_bolt 153640 177397 590 7.59 3951 8072 38.1 38.1 17.3% 0.0% 0.0% 0.0% 24.45sec 177397 300.79sec
lightforged draenei lightforged draenei arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.01sec 0 300.79sec
lightforged draenei lightforged draenei conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
lightforged draenei lightforged draenei deathly_fixation ticks -322253 4603 15 8.23 112 0 14.3 41.1 0.0% 0.0% 0.0% 0.0% 1.78sec 4603 300.79sec
lightforged draenei lightforged draenei deathly_eruption 322256 2674 9 0.40 1114 2229 2.0 2.0 19.6% 0.0% 0.0% 0.0% 9.59sec 2674 300.79sec
lightforged draenei lightforged draenei eternal_insight 342314 10786 36 4.05 452 904 20.3 20.3 17.4% 0.0% 0.0% 0.0% 14.53sec 10786 300.79sec
lightforged draenei lightforged draenei evocation 12051 0 0 0.00 0 0 0.4 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
lightforged draenei lightforged draenei flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
lightforged draenei lightforged draenei food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
lightforged draenei lightforged draenei lights_judgment 255647 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 150.46sec 0 300.79sec
lightforged draenei lightforged draenei lights_judgment_damage 256893 54711 182 1.49 6266 12564 2.5 7.4 17.1% 0.0% 0.0% 0.0% 150.73sec 54711 300.79sec
lightforged draenei lightforged draenei mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
lightforged draenei lightforged draenei_mirror_image frostbolt 59638 4078 102 135.00 38 78 90.0 90.0 18.2% 0.0% 0.0% 0.0% 1.31sec 4078 40.00sec
lightforged draenei lightforged draenei potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
lightforged draenei lightforged draenei rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.21sec 0 300.79sec
lightforged draenei lightforged draenei touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.92sec 0 300.79sec
lightforged draenei lightforged draenei touch_of_the_magi_explosion 210833 156635 521 3.69 8464 0 6.2 18.5 0.0% 0.0% 0.0% 0.0% 51.83sec 156635 300.79sec
lightforged draenei lightforged draenei use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.81sec 0 300.79sec
mechagnome mechagnome arcane_barrage 44425 1140782 3793 29.88 6439 13274 50.0 149.8 17.3% 0.0% 0.0% 0.0% 6.05sec 1140782 300.79sec
mechagnome mechagnome arcane_blast 30451 1044 3 0.20 912 1823 0.0 1.0 14.6% 0.0% 0.0% 0.0% 0.00sec 1044 300.79sec
mechagnome mechagnome arcane_explosion 1449 888540 2954 77.42 1940 3972 129.4 388.1 17.2% 0.0% 0.0% 0.0% 2.30sec 888540 300.79sec
mechagnome mechagnome arcane_missiles ticks -5143 309015 1030 39.15 1343 2732 24.5 195.8 17.1% 0.0% 0.0% 0.0% 11.68sec 309015 300.79sec
mechagnome mechagnome arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.44sec 0 300.79sec
mechagnome mechagnome arcane_orb_bolt 153640 181006 602 7.59 4037 8193 38.1 38.1 17.3% 0.0% 0.0% 0.0% 24.44sec 181006 300.79sec
mechagnome mechagnome arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.10sec 0 300.79sec
mechagnome mechagnome conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
mechagnome mechagnome deathly_fixation ticks -322253 4546 15 8.12 112 0 13.9 40.6 0.0% 0.0% 0.0% 0.0% 1.82sec 4546 300.79sec
mechagnome mechagnome deathly_eruption 322256 2578 9 0.38 1115 2227 1.9 1.9 20.1% 0.0% 0.0% 0.0% 9.27sec 2578 300.79sec
mechagnome mechagnome eternal_insight 342314 10717 36 4.04 452 905 20.3 20.3 17.0% 0.0% 0.0% 0.0% 14.46sec 10717 300.79sec
mechagnome mechagnome evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
mechagnome mechagnome flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
mechagnome mechagnome food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
mechagnome mechagnome mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
mechagnome mechagnome_mirror_image frostbolt 59638 4131 103 135.00 39 78 90.0 90.0 18.3% 0.0% 0.0% 0.0% 1.31sec 4131 40.00sec
mechagnome mechagnome potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
mechagnome mechagnome rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.20sec 0 300.79sec
mechagnome mechagnome touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.04sec 0 300.79sec
mechagnome mechagnome touch_of_the_magi_explosion 210833 159588 531 3.70 8599 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.90sec 159588 300.79sec
mechagnome mechagnome use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 122.95sec 0 300.79sec
night_elf night_elf arcane_barrage 44425 1123977 3737 29.90 6302 12886 50.0 149.9 18.2% 0.0% 0.0% 0.0% 6.02sec 1123977 300.79sec
night_elf night_elf arcane_blast 30451 1042 3 0.20 910 1820 0.0 1.0 14.5% 0.0% 0.0% 0.0% 0.00sec 1042 300.79sec
night_elf night_elf arcane_explosion 1449 879766 2925 77.56 1899 3891 129.6 388.8 18.3% 0.0% 0.0% 0.0% 2.29sec 879766 300.79sec
night_elf night_elf arcane_missiles ticks -5143 302657 1009 38.81 1315 2675 24.3 194.1 18.1% 0.0% 0.0% 0.0% 11.96sec 302657 300.79sec
night_elf night_elf arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.35sec 0 300.79sec
night_elf night_elf arcane_orb_bolt 153640 178757 594 7.59 3940 8057 38.1 38.1 18.4% 0.0% 0.0% 0.0% 24.36sec 178757 300.79sec
night_elf night_elf arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.13sec 0 300.79sec
night_elf night_elf conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
night_elf night_elf deathly_fixation ticks -322253 4521 15 8.06 112 0 13.7 40.3 0.0% 0.0% 0.0% 0.0% 1.82sec 4521 300.79sec
night_elf night_elf deathly_eruption 322256 2561 9 0.38 1113 2229 1.9 1.9 20.8% 0.0% 0.0% 0.0% 10.12sec 2561 300.79sec
night_elf night_elf eternal_insight 342314 10785 36 4.03 452 905 20.2 20.2 18.0% 0.0% 0.0% 0.0% 14.55sec 10785 300.79sec
night_elf night_elf evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
night_elf night_elf flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
night_elf night_elf food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
night_elf night_elf mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
night_elf night_elf_mirror_image frostbolt 59638 4124 103 135.00 38 78 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.31sec 4124 40.00sec
night_elf night_elf potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
night_elf night_elf rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.23sec 0 300.79sec
night_elf night_elf touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.09sec 0 300.79sec
night_elf night_elf touch_of_the_magi_explosion 210833 157294 523 3.70 8492 0 6.2 18.5 0.0% 0.0% 0.0% 0.0% 52.00sec 157294 300.79sec
night_elf night_elf use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.23sec 0 300.79sec
no_race no_race arcane_barrage 44425 1115936 3710 29.91 6324 12844 50.0 150.0 17.2% 0.0% 0.0% 0.0% 6.03sec 1115936 300.79sec
no_race no_race arcane_blast 30451 1059 4 0.20 910 1820 0.0 1.0 16.4% 0.0% 0.0% 0.0% 0.00sec 1059 300.79sec
no_race no_race arcane_explosion 1449 870845 2895 77.46 1899 3900 129.4 388.3 17.2% 0.0% 0.0% 0.0% 2.29sec 870845 300.79sec
no_race no_race arcane_missiles ticks -5143 300755 1003 39.00 1311 2672 24.4 195.0 17.1% 0.0% 0.0% 0.0% 11.89sec 300755 300.79sec
no_race no_race arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.43sec 0 300.79sec
no_race no_race arcane_orb_bolt 153640 178028 592 7.61 3955 8073 38.2 38.2 17.3% 0.0% 0.0% 0.0% 24.43sec 178028 300.79sec
no_race no_race arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.21sec 0 300.79sec
no_race no_race conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
no_race no_race deathly_fixation ticks -322253 4568 15 8.12 113 0 13.9 40.6 0.0% 0.0% 0.0% 0.0% 1.82sec 4568 300.79sec
no_race no_race deathly_eruption 322256 2558 9 0.38 1114 2230 1.9 1.9 19.5% 0.0% 0.0% 0.0% 10.11sec 2558 300.79sec
no_race no_race eternal_insight 342314 10783 36 4.05 452 904 20.3 20.3 17.4% 0.0% 0.0% 0.0% 14.46sec 10783 300.79sec
no_race no_race evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
no_race no_race flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
no_race no_race food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
no_race no_race mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
no_race no_race_mirror_image frostbolt 59638 4091 102 135.00 38 78 90.0 90.0 18.4% 0.0% 0.0% 0.0% 1.31sec 4091 40.00sec
no_race no_race potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
no_race no_race rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.37sec 0 300.79sec
no_race no_race touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.15sec 0 300.79sec
no_race no_race touch_of_the_magi_explosion 210833 156600 521 3.70 8443 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 52.01sec 156600 300.79sec
no_race no_race use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.60sec 0 300.79sec
pandaren pandaren arcane_barrage 44425 1131623 3762 29.91 6374 13167 50.0 149.9 17.3% 0.0% 0.0% 0.0% 6.04sec 1131623 300.79sec
pandaren pandaren arcane_blast 30451 1067 4 0.20 922 1843 0.0 1.0 15.7% 0.0% 0.0% 0.0% 0.00sec 1067 300.79sec
pandaren pandaren arcane_explosion 1449 880625 2928 77.46 1922 3940 129.4 388.3 17.1% 0.0% 0.0% 0.0% 2.30sec 880625 300.79sec
pandaren pandaren arcane_missiles ticks -5143 304261 1014 38.89 1332 2710 24.4 194.5 17.0% 0.0% 0.0% 0.0% 11.75sec 304261 300.79sec
pandaren pandaren arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.31sec 0 300.79sec
pandaren pandaren arcane_orb_bolt 153640 180186 599 7.61 3999 8203 38.2 38.2 17.1% 0.0% 0.0% 0.0% 24.31sec 180186 300.79sec
pandaren pandaren arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.09sec 0 300.79sec
pandaren pandaren conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
pandaren pandaren deathly_fixation ticks -322253 4594 15 8.19 112 0 13.8 40.9 0.0% 0.0% 0.0% 0.0% 1.76sec 4594 300.79sec
pandaren pandaren deathly_eruption 322256 2542 8 0.38 1114 2226 1.9 1.9 19.8% 0.0% 0.0% 0.0% 9.35sec 2542 300.79sec
pandaren pandaren eternal_insight 342314 10764 36 4.05 452 904 20.3 20.3 17.2% 0.0% 0.0% 0.0% 14.29sec 10764 300.79sec
pandaren pandaren evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
pandaren pandaren flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
pandaren pandaren food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
pandaren pandaren mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
pandaren pandaren_mirror_image frostbolt 59638 4141 104 135.00 39 79 90.0 90.0 18.4% 0.0% 0.0% 0.0% 1.31sec 4141 40.00sec
pandaren pandaren potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
pandaren pandaren rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.37sec 0 300.79sec
pandaren pandaren touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.06sec 0 300.79sec
pandaren pandaren touch_of_the_magi_explosion 210833 159461 530 3.70 8592 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.97sec 159461 300.79sec
pandaren pandaren use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.41sec 0 300.79sec
void_elf void_elf arcane_barrage 44425 1116182 3711 29.88 6312 12874 50.0 149.8 17.4% 0.0% 0.0% 0.0% 6.03sec 1116182 300.79sec
void_elf void_elf arcane_blast 30451 1031 3 0.20 912 1823 0.0 1.0 13.1% 0.0% 0.0% 0.0% 0.00sec 1031 300.79sec
void_elf void_elf arcane_explosion 1449 871982 2899 77.45 1903 3899 129.4 388.2 17.2% 0.0% 0.0% 0.0% 2.29sec 871982 300.79sec
void_elf void_elf arcane_missiles ticks -5143 302536 1008 39.01 1319 2686 24.4 195.0 17.1% 0.0% 0.0% 0.0% 11.89sec 302536 300.79sec
void_elf void_elf arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.38sec 0 300.79sec
void_elf void_elf arcane_orb_bolt 153640 176374 586 7.59 3944 8031 38.0 38.0 17.0% 0.0% 0.0% 0.0% 24.38sec 176374 300.79sec
void_elf void_elf arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.14sec 0 300.79sec
void_elf void_elf conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
void_elf void_elf deathly_fixation ticks -322253 4591 15 8.18 112 0 13.9 40.9 0.0% 0.0% 0.0% 0.0% 1.76sec 4591 300.79sec
void_elf void_elf deathly_eruption 322256 2539 8 0.38 1115 2234 1.9 1.9 19.9% 0.0% 0.0% 0.0% 9.46sec 2539 300.79sec
void_elf void_elf entropic_embrace 259756 36228 120 33.21 218 0 166.5 166.5 0.0% 0.0% 0.0% 0.0% 3.45sec 36228 300.79sec
void_elf void_elf eternal_insight 342314 10738 36 4.04 452 904 20.2 20.2 17.3% 0.0% 0.0% 0.0% 14.43sec 10738 300.79sec
void_elf void_elf evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
void_elf void_elf flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
void_elf void_elf food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
void_elf void_elf mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
void_elf void_elf_mirror_image frostbolt 59638 4094 102 135.00 38 77 90.0 90.0 18.3% 0.0% 0.0% 0.0% 1.31sec 4094 40.00sec
void_elf void_elf potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
void_elf void_elf rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.18sec 0 300.79sec
void_elf void_elf touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.92sec 0 300.79sec
void_elf void_elf touch_of_the_magi_explosion 210833 157482 524 3.70 8491 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 51.80sec 157482 300.79sec
void_elf void_elf use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.64sec 0 300.79sec
worgen worgen arcane_barrage 44425 1123600 3735 29.93 6302 12874 50.1 150.1 18.1% 0.0% 0.0% 0.0% 6.02sec 1123600 300.79sec
worgen worgen arcane_blast 30451 1055 4 0.20 908 1817 0.0 1.0 16.1% 0.0% 0.0% 0.0% 0.00sec 1055 300.79sec
worgen worgen arcane_explosion 1449 878813 2922 77.60 1897 3885 129.7 389.0 18.2% 0.0% 0.0% 0.0% 2.29sec 878813 300.79sec
worgen worgen arcane_missiles ticks -5143 298769 996 38.55 1307 2660 24.2 192.8 18.0% 0.0% 0.0% 0.0% 11.91sec 298769 300.79sec
worgen worgen arcane_orb 153626 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.43sec 0 300.79sec
worgen worgen arcane_orb_bolt 153640 179633 597 7.61 3953 8051 38.1 38.1 18.5% 0.0% 0.0% 0.0% 24.43sec 179633 300.79sec
worgen worgen arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.21sec 0 300.79sec
worgen worgen conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
worgen worgen deathly_fixation ticks -322253 4481 15 8.06 111 0 13.8 40.3 0.0% 0.0% 0.0% 0.0% 1.81sec 4481 300.79sec
worgen worgen deathly_eruption 322256 2576 9 0.38 1115 2227 1.9 1.9 21.4% 0.0% 0.0% 0.0% 10.00sec 2576 300.79sec
worgen worgen eternal_insight 342314 10824 36 4.05 452 904 20.3 20.3 18.0% 0.0% 0.0% 0.0% 14.35sec 10824 300.79sec
worgen worgen evocation 12051 0 0 0.00 0 0 0.5 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
worgen worgen flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
worgen worgen food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
worgen worgen mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
worgen worgen_mirror_image frostbolt 59638 4123 103 135.00 38 77 90.0 90.0 19.5% 0.0% 0.0% 0.0% 1.31sec 4123 40.00sec
worgen worgen potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.79sec
worgen worgen rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.48sec 0 300.79sec
worgen worgen touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.27sec 0 300.79sec
worgen worgen touch_of_the_magi_explosion 210833 158022 525 3.70 8519 0 6.2 18.6 0.0% 0.0% 0.0% 0.0% 52.19sec 158022 300.79sec
worgen worgen use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.60sec 0 300.79sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
59418.9 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 41.9sec 9.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 103.3s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.43%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 21.2sec 6.10% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 38.3s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.12%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 23.2sec 7.47% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 37.6s

Stack Uptimes

  • Health Decade (20 - 30)_1:7.47%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 31.2sec 10.43% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.8s / 42.5s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.43%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.5sec 11.85% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.0s / 49.5s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.85%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 34.2sec 11.49% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:21.8s / 56.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.49%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.7sec 12.70% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.0s / 44.8s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.70%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 40.9sec 13.80% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:33.5s / 51.6s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.80%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 33.6sec 11.35% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.3s / 49.0s

Stack Uptimes

  • Health Decade (80 - 90)_1:11.35%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 20.0sec 5.41% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:5.41%
Sinful Revelation 4.3 0.7 56.1sec 46.0sec 10.6sec 15.07% 0.00% 0.7 (0.7) 4.1

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 293.9s
  • trigger_min/max:0.2s / 293.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 36.7s

Stack Uptimes

  • sinful_revelation_1:15.07%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.8 56.5sec 45.8sec 10.6sec 15.03% 0.00% 0.8 (0.8) 4.1

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 280.7s
  • trigger_min/max:0.2s / 276.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 34.3s

Stack Uptimes

  • sinful_revelation_1:15.03%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.4 0.7 56.1sec 46.2sec 10.6sec 15.39% 0.00% 0.7 (0.7) 4.2

Buff Details

  • buff initial source:human
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 330.7s
  • trigger_min/max:0.2s / 330.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 31.6s

Stack Uptimes

  • sinful_revelation_1:15.39%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.7 55.5sec 46.3sec 10.5sec 15.12% 0.00% 0.7 (0.7) 4.2

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 310.1s
  • trigger_min/max:0.2s / 310.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 31.9s

Stack Uptimes

  • sinful_revelation_1:15.12%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.7 55.3sec 45.7sec 10.6sec 15.12% 0.00% 0.7 (0.7) 4.2

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 262.4s
  • trigger_min/max:0.2s / 262.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 32.2s

Stack Uptimes

  • sinful_revelation_1:15.12%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.2 0.7 56.0sec 46.2sec 10.6sec 14.85% 0.00% 0.7 (0.7) 4.1

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 340.4s
  • trigger_min/max:0.2s / 340.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 37.4s

Stack Uptimes

  • sinful_revelation_1:14.85%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.8 55.7sec 45.3sec 10.6sec 15.24% 0.00% 0.8 (0.8) 4.2

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 278.4s
  • trigger_min/max:0.2s / 278.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 31.9s

Stack Uptimes

  • sinful_revelation_1:15.24%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.8 55.4sec 44.9sec 10.7sec 15.19% 0.00% 0.8 (0.8) 4.1

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 316.6s
  • trigger_min/max:0.2s / 310.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 49.6s

Stack Uptimes

  • sinful_revelation_1:15.19%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.4 0.7 55.4sec 45.9sec 10.6sec 15.41% 0.00% 0.7 (0.7) 4.2

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 296.7s
  • trigger_min/max:0.2s / 296.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 31.9s

Stack Uptimes

  • sinful_revelation_1:15.41%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.8 55.5sec 45.1sec 10.6sec 15.36% 0.00% 0.8 (0.8) 4.2

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 247.8s
  • trigger_min/max:0.2s / 247.8s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 33.9s

Stack Uptimes

  • sinful_revelation_1:15.36%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.7 55.5sec 46.0sec 10.5sec 15.07% 0.00% 0.7 (0.7) 4.2

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 273.7s
  • trigger_min/max:0.2s / 273.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 32.8s

Stack Uptimes

  • sinful_revelation_1:15.07%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.7 54.6sec 45.1sec 10.6sec 15.16% 0.00% 0.7 (0.7) 4.2

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 278.3s
  • trigger_min/max:0.2s / 278.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 28.9s

Stack Uptimes

  • sinful_revelation_1:15.16%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.8 55.5sec 45.0sec 10.6sec 15.28% 0.00% 0.8 (0.8) 4.2

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 311.2s
  • trigger_min/max:0.2s / 311.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 30.5s

Stack Uptimes

  • sinful_revelation_1:15.28%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 4.3 0.7 55.0sec 45.7sec 10.6sec 15.23% 0.00% 0.7 (0.7) 4.2

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 303.9s
  • trigger_min/max:0.2s / 303.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 32.4s

Stack Uptimes

  • sinful_revelation_1:15.23%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Touch of the Magi 6.2 0.0 51.6sec 51.7sec 7.9sec 16.43% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 76.0s
  • trigger_min/max:46.3s / 76.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.43%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.9sec 52.1sec 7.9sec 16.38% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 72.4s
  • trigger_min/max:46.3s / 72.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.38%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.8sec 51.9sec 7.9sec 16.38% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:human
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 95.7s
  • trigger_min/max:46.3s / 95.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.38%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 52.0sec 52.1sec 7.9sec 16.37% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 93.8s
  • trigger_min/max:46.3s / 93.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.37%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 52.0sec 52.1sec 7.9sec 16.38% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 91.6s
  • trigger_min/max:46.3s / 91.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.38%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.9sec 52.1sec 7.9sec 16.35% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 71.5s
  • trigger_min/max:46.3s / 71.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.35%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.6sec 51.8sec 7.9sec 16.42% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 84.6s
  • trigger_min/max:46.3s / 84.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.42%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.9sec 52.0sec 7.9sec 16.36% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 90.8s
  • trigger_min/max:46.3s / 90.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.36%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.8sec 52.0sec 7.9sec 16.32% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 71.6s
  • trigger_min/max:46.3s / 71.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.32%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.8sec 52.0sec 7.9sec 16.36% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 71.7s
  • trigger_min/max:46.3s / 71.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.36%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 52.0sec 52.1sec 7.9sec 16.35% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 72.1s
  • trigger_min/max:46.3s / 72.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.35%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.9sec 52.0sec 7.9sec 16.36% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 72.1s
  • trigger_min/max:46.3s / 72.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.36%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.9sec 52.1sec 7.9sec 16.37% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 93.7s
  • trigger_min/max:46.3s / 93.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.37%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 52.0sec 52.1sec 7.9sec 16.35% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 74.9s
  • trigger_min/max:46.3s / 74.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.35%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
Fluffy_Pillow Damage Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1118
Mean 63653.76
Minimum 59645.14
Maximum 67147.58
Spread ( max - min ) 7502.44
Range [ ( max - min ) / 2 * 100% ] 5.89%
Standard Deviation 1321.5356
5th Percentile 61505.10
95th Percentile 65848.69
( 95th Percentile - 5th Percentile ) 4343.59
Mean Distribution
Standard Deviation 39.5237
95.00% Confidence Interval ( 63576.30 - 63731.23 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1656
0.1 Scale Factor Error with Delta=300 14909
0.05 Scale Factor Error with Delta=300 59636
0.01 Scale Factor Error with Delta=300 1490876
HPS
Fluffy_Pillow Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 216
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 19364235 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
28130.4 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 40.6sec 9.04% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 109.8s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.06%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 22.0sec 6.43% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 41.2s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.44%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 24.1sec 7.85% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 38.9s

Stack Uptimes

  • Health Decade (20 - 30)_1:7.85%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.9sec 11.03% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:18.1s / 43.4s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.03%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 36.6sec 12.21% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.7s / 52.6s

Stack Uptimes

  • Health Decade (40 - 50)_1:12.21%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 32.6sec 10.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.5s / 55.8s

Stack Uptimes

  • Health Decade (50 - 60)_1:10.94%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 38.2sec 12.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.4s / 46.3s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.87%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 42.5sec 14.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:34.3s / 54.3s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.33%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 32.3sec 10.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.8s / 50.7s

Stack Uptimes

  • Health Decade (80 - 90)_1:10.88%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.1sec 4.41% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.41%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2072
death count pct 182.72
avg death time 293.47
min death time 240.03
max death time 359.95
dmg taken 8982651.18

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
enemy2 Damage Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1118
Mean 29873.45
Minimum 28008.14
Maximum 31771.34
Spread ( max - min ) 3763.20
Range [ ( max - min ) / 2 * 100% ] 6.30%
Standard Deviation 679.3907
5th Percentile 28738.04
95th Percentile 30971.85
( 95th Percentile - 5th Percentile ) 2233.81
Mean Distribution
Standard Deviation 20.3188
95.00% Confidence Interval ( 29833.62 - 29913.27 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1987
0.1 Scale Factor Error with Delta=300 3941
0.05 Scale Factor Error with Delta=300 15761
0.01 Scale Factor Error with Delta=300 394025
HPS
enemy2 Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 216
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 8809156 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
29073.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 42.6sec 9.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 105.1s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.22%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 22.7sec 6.57% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 41.4s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.58%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 24.3sec 7.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 39.3s

Stack Uptimes

  • Health Decade (20 - 30)_1:7.96%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 33.5sec 11.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.7s / 44.5s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.22%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 36.1sec 12.07% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:17.2s / 52.7s

Stack Uptimes

  • Health Decade (40 - 50)_1:12.07%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 33.2sec 11.14% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.6s / 55.7s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.14%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 38.5sec 12.98% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.0s / 46.9s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.98%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 42.9sec 14.46% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.8s / 56.6s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.46%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 29.9sec 10.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 49.9s

Stack Uptimes

  • Health Decade (80 - 90)_1:10.06%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 16.9sec 4.34% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.34%
Sinful Revelation 8.4 3.4 34.1sec 23.6sec 11.8sec 32.78% 0.00% 3.4 (3.4) 8.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 205.2s
  • trigger_min/max:0.9s / 192.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.2s

Stack Uptimes

  • sinful_revelation_1:32.78%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.3 3.2 34.4sec 24.1sec 11.7sec 32.33% 0.00% 3.2 (3.2) 8.0

Buff Details

  • buff initial source:pandaren
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 184.3s
  • trigger_min/max:1.0s / 184.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 47.6s

Stack Uptimes

  • sinful_revelation_1:32.33%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.4 3.3 34.0sec 23.8sec 11.7sec 32.67% 0.00% 3.3 (3.3) 8.1

Buff Details

  • buff initial source:human
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 177.7s
  • trigger_min/max:1.0s / 177.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 52.4s

Stack Uptimes

  • sinful_revelation_1:32.67%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.3 3.3 34.6sec 24.0sec 11.7sec 32.35% 0.00% 3.3 (3.3) 7.9

Buff Details

  • buff initial source:worgen
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 197.6s
  • trigger_min/max:1.0s / 197.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.3s

Stack Uptimes

  • sinful_revelation_1:32.35%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.3 3.2 34.4sec 24.1sec 11.7sec 32.26% 0.00% 3.2 (3.2) 8.0

Buff Details

  • buff initial source:dwarf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 217.7s
  • trigger_min/max:1.0s / 209.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.3s

Stack Uptimes

  • sinful_revelation_1:32.26%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.4 3.2 34.1sec 24.0sec 11.6sec 32.50% 0.00% 3.2 (3.2) 8.0

Buff Details

  • buff initial source:night_elf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 194.0s
  • trigger_min/max:1.0s / 194.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 44.5s

Stack Uptimes

  • sinful_revelation_1:32.50%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.4 3.1 34.3sec 24.2sec 11.7sec 32.46% 0.00% 3.1 (3.1) 8.0

Buff Details

  • buff initial source:gnome
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 206.8s
  • trigger_min/max:1.0s / 196.4s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 54.0s

Stack Uptimes

  • sinful_revelation_1:32.46%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.4 3.3 34.2sec 23.8sec 11.8sec 32.72% 0.00% 3.3 (3.3) 8.0

Buff Details

  • buff initial source:draenei
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.1s / 189.3s
  • trigger_min/max:1.0s / 189.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 54.7s

Stack Uptimes

  • sinful_revelation_1:32.72%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.4 3.2 34.1sec 23.9sec 11.7sec 32.49% 0.00% 3.2 (3.2) 8.0

Buff Details

  • buff initial source:lightforged draenei
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 175.1s
  • trigger_min/max:0.4s / 175.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 50.6s

Stack Uptimes

  • sinful_revelation_1:32.49%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.4 3.2 34.2sec 24.1sec 11.7sec 32.37% 0.00% 3.2 (3.2) 8.0

Buff Details

  • buff initial source:void_elf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 166.0s
  • trigger_min/max:1.0s / 157.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 51.2s

Stack Uptimes

  • sinful_revelation_1:32.37%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.4 3.2 34.1sec 24.0sec 11.7sec 32.50% 0.00% 3.2 (3.2) 8.0

Buff Details

  • buff initial source:dark_iron_dwarf
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 165.6s
  • trigger_min/max:1.0s / 165.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 45.0s

Stack Uptimes

  • sinful_revelation_1:32.50%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.4 3.4 34.3sec 23.8sec 11.8sec 32.80% 0.00% 3.4 (3.4) 8.0

Buff Details

  • buff initial source:mechagnome
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 206.9s
  • trigger_min/max:1.0s / 206.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 46.1s

Stack Uptimes

  • sinful_revelation_1:32.80%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.3 3.2 34.6sec 24.2sec 11.7sec 32.11% 0.00% 3.2 (3.2) 7.9

Buff Details

  • buff initial source:kul_tiran
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 173.9s
  • trigger_min/max:1.0s / 173.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 55.8s

Stack Uptimes

  • sinful_revelation_1:32.11%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Sinful Revelation 8.4 3.3 34.2sec 23.8sec 11.7sec 32.66% 0.00% 3.3 (3.3) 8.0

Buff Details

  • buff initial source:no_race
  • cooldown name:buff_sinful_revelation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.06
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 217.8s
  • trigger_min/max:1.0s / 217.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 49.4s

Stack Uptimes

  • sinful_revelation_1:32.66%

Spelldata

  • id:324260
  • name:Sinful Revelation
  • tooltip:Increase damage taken by $w1% from aura caster.
  • description:
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 2072
death count pct 182.72
avg death time 293.47
min death time 240.03
max death time 359.95
dmg taken 9320855.68

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1118
Mean 300.79
Minimum 240.03
Maximum 359.99
Spread ( max - min ) 119.96
Range [ ( max - min ) / 2 * 100% ] 19.94%
DPS
enemy3 Damage Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1118
Mean 31003.06
Minimum 29048.14
Maximum 32795.49
Spread ( max - min ) 3747.35
Range [ ( max - min ) / 2 * 100% ] 6.04%
Standard Deviation 700.1029
5th Percentile 29919.03
95th Percentile 32186.30
( 95th Percentile - 5th Percentile ) 2267.27
Mean Distribution
Standard Deviation 20.9383
95.00% Confidence Interval ( 30962.02 - 31044.10 )
Normalized 95.00% Confidence Interval ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 20
0.1% Error 1959
0.1 Scale Factor Error with Delta=300 4185
0.05 Scale Factor Error with Delta=300 16737
0.01 Scale Factor Error with Delta=300 418416
HPS
enemy3 Healing Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1118
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 216
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 10626805 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.